DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and ACTL8

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_110439.2 Gene:ACTL8 / 81569 HGNCID:24018 Length:366 Species:Homo sapiens


Alignment Length:431 Identity:69/431 - (16%)
Similarity:134/431 - (31%) Gaps:147/431 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 FPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLK---IPLRKLGTHCAVLVVNDVYVRR-- 238
            :||:||.:           .:.:.::.:||:.||...:   :|         .:::.:..:|.  
Human    65 YPIERGRI-----------LNWEGVQYLWSFVLENHRREQEVP---------PVIITETPLREPA 109

  Fly   239 HLREFVTLLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIEDGISQLDARVRLS 303
            ..::.:.:|...|......|......|.:.:|:..|.|||.|...|.:.....|.....:...|.
Human   110 DRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLE 174

  Fly   304 YGGGDLDQVLLLLL------RKCGFPYRECNV---QESYVDAHLLDELKEKFCHLNASVCGAQEK 359
            :.|.||...||..|      |:|.|......|   .:.||..:|.:.|..:           :.:
Human   175 FAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFR-----------ERQ 228

  Fly   360 HFNLRKHNGQWLRYTIQVGDEALMAPLALFHTELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYL 424
            ...|.:.|    .|.:..|....:.|:                   |:...:.:.....|:    
Human   229 QSALDESN----TYQLPDGSRVELTPM-------------------QRVAPEMFFSPQVFE---- 266

  Fly   425 KETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQSQLGAQTAGGQMNS 489
                                   ||.|.:|      ..||    |::.:|:..|           
Human   267 -----------------------QPGPSIP------RAIV----ESVESCEISL----------- 287

  Fly   490 NGCYHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLAAWL-EQRISQQVQS 553
                       .||                   :...::..|.:...||....| .:.:...|.|
Human   288 -----------RPL-------------------LVSHVMACGGNTLYPGFTKRLFRELMGDHVSS 322

  Fly   554 EVNVLIKGMDAGMVAWKGAAIMSVLESARELWISQNDWQRH 594
            ....:.:|.:.....|.||::::.|.:.:..|:|:.::..|
Human   323 TKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEH 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 65/408 (16%)
ACTL8NP_110439.2 ACTIN 4..363 CDD:214592 68/429 (16%)
NBD_sugar-kinase_HSP70_actin 7..362 CDD:302596 68/428 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.