DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and Ankrd36

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_076305.2 Gene:Ankrd36 / 76389 MGIID:1923639 Length:1415 Species:Mus musculus


Alignment Length:315 Identity:69/315 - (21%)
Similarity:115/315 - (36%) Gaps:92/315 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 RVRLSYGGGDLDQVLLLLLRKCGFPYRECNVQESYVDAHLLDELKEKFCHLNASVCGAQEKHFNL 363
            |:..:...||:.||..:|             :...:|.::.|..|....|. |...|..|     
Mouse    36 RIHKAASVGDIPQVQKML-------------EFGDIDVNVTDRKKRTALHY-ACAHGQSE----- 81

  Fly   364 RKHNGQWLRYTIQVGDEALMAPLALFHTELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYLKETG 428
                               |..|.|::...:....|.::....:|.|.|:  |.|  .:.|.|.|
Mouse    82 -------------------MVSLLLWYDCNIEARDREESTALIKATQRQH--EIC--VKILLENG 123

  Fly   429 R-KNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQSQLGAQTAGGQMNSNGC 492
            . .|.|   ||.| :||..|               .|.::|.||:   ::|.|..|..::.:...
Mouse   124 ADSNAV---DIHQ-NTSLHY---------------TVYNKDTTIA---AKLLAFNADTEVKTKNG 166

  Fly   493 YHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGL----AAWLEQRISQQVQS 553
            |       .||..|::         |.|::|..  ||:.::|.:..|    .:.|...:..|.::
Mouse   167 Y-------TPLILAVL---------ENKQEMVE--LLLQAAANINALDNCKRSALIHAVRTQSKN 213

  Fly   554 EVNVLI-KGMDAGMVAWKGAAIMS--VLESARELWISQNDWQRHGLRVLRERSPF 605
            .:::|: :|.:|.:|...||...|  |.|:.:.|  ||....|..|.....|..|
Mouse   214 MISLLLQQGANASLVDIYGATAQSYAVFETFQVL--SQGPGPRPELTTKEARHSF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 67/311 (22%)
Ankrd36NP_076305.2 Ank_2 37..130 CDD:289560 26/137 (19%)
ANK repeat 37..64 CDD:293786 6/39 (15%)
ANK 61..186 CDD:238125 41/193 (21%)
ANK repeat 68..97 CDD:293786 7/53 (13%)
ANK repeat 99..130 CDD:293786 10/37 (27%)
ANK repeat 132..163 CDD:293786 11/49 (22%)
Ank_2 137..229 CDD:289560 24/127 (19%)
ANK 162..>240 CDD:238125 20/95 (21%)
ANK repeat 165..196 CDD:293786 10/48 (21%)
ANK repeat 198..229 CDD:293786 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.