DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and ACTR3C

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_016868037.1 Gene:ACTR3C / 653857 HGNCID:37282 Length:280 Species:Homo sapiens


Alignment Length:139 Identity:33/139 - (23%)
Similarity:55/139 - (39%) Gaps:31/139 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 GCVVDIGAQKTSIACIEDGISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECNV--QESYVDA 336
            |.|:|.|...|.:..:.:|.........:...|.|:...:..|||:     ||..:  ::|...|
Human    36 GIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRE-----REVGIPPEQSLETA 95

  Fly   337 HLLDELKEKFCHLNASVCGAQEKHFNLRKHN---GQWL------------RYTIQVGDEALMAPL 386
               ..:|||:|:    :|....|.|  .|::   .:|:            ::.|.||.|..:.|.
Human    96 ---KAIKEKYCY----ICPDIVKEF--AKYDVDPQKWIKQYTGINAINQKKFVIDVGYERFLGPE 151

  Fly   387 ALFHTELLN 395
            ..||.|..|
Human   152 IFFHPEFAN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 33/139 (24%)
ACTR3CXP_016868037.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.