DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and ACTR3B

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_065178.1 Gene:ACTR3B / 57180 HGNCID:17256 Length:418 Species:Homo sapiens


Alignment Length:537 Identity:97/537 - (18%)
Similarity:165/537 - (30%) Gaps:207/537 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VVDNKNRLRVATPPQQLAHF------NRSSQAEKVPAPSGQMADEPWLDR-EAPVLFDDRILRLG 168
            |||...| ||......|..|      ::.:.|.|.|...|.:.|...::| ...|:|  :.||  
Human    43 VVDQAQR-RVLRGVDDLDFFIGDEAIDKPTYATKWPIRHGIIEDWDLMERFMEQVVF--KYLR-- 102

  Fly   169 AVDARNYDIHFPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKIPLRKLGTHCAVLVVND 233
               |...|.:|.:....||....:        ::|..|    :.|...:|    |.:.||..|  
Human   103 ---AEPEDHYFLMTEPPLNTPENR--------EYLAEI----MFESFNVP----GLYIAVQAV-- 146

  Fly   234 VYVRRHLREFVTLLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIEDGISQLDA 298
                  |....:...|::|.|..                .|.|:|.|...|.:..:.:|......
Human   147 ------LALAASWTSRQVGERTL----------------TGIVIDSGDGVTHVIPVAEGYVIGSC 189

  Fly   299 RVRLSYGGGDLDQVLLLLLRKCGFPYRECNV--QESYVDAHLLDELKEKFCHLNASVCGAQEKHF 361
            ...:...|.|:...:..|||:     ||..:  ::|...|   ..:|||:|:    :|....|.|
Human   190 IKHIPIAGRDITYFIQQLLRE-----REVGIPPEQSLETA---KAIKEKYCY----ICPDIVKEF 242

  Fly   362 NLRKHN---GQWL------------RYTIQVGDEALMAPLALFHTELLNITGRTKAVFTQQAVQD 411
              .|::   .:|:            ::.|.||.|..:.|...||.|..|                
Human   243 --AKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFAN---------------- 289

  Fly   412 QYDCEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQS 476
                                                   |....:..|    ||  ||.|.||  
Human   290 ---------------------------------------PDFMESISD----VV--DEVIQNC-- 307

  Fly   477 QLGAQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLAA 541
                                     |:|              .:|.::.:::|.|.|........
Human   308 -------------------------PID--------------VRRPLYKNVVLSGGSTMFRDFGR 333

  Fly   542 WLEQ----------RISQQVQS--------EVNVLIKGMDAGMVAWKGAAIMSVLESARELWISQ 588
            .|::          |:|:::..        ||.|:...|....| |.|.::::......::..::
Human   334 RLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAV-WFGGSMLASTPEFFQVCHTK 397

  Fly   589 NDWQRHGLRVLRERSPF 605
            .|::.:|..:.|....|
Human   398 KDYEEYGPSICRHNPVF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 73/435 (17%)
ACTR3BNP_065178.1 PTZ00280 2..417 CDD:240343 97/537 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.