DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and ACTL6B

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_057272.1 Gene:ACTL6B / 51412 HGNCID:160 Length:426 Species:Homo sapiens


Alignment Length:409 Identity:72/409 - (17%)
Similarity:133/409 - (32%) Gaps:131/409 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 VLVVNDVYVRRHLREFVT-LLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIED 291
            ||:....:..|..||.:| |:..:......||.:.:|.:.|..|...|.|:|.||..|:...:.|
Human   117 VLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHD 181

  Fly   292 GISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECN--VQESYVD---AHLL---DELKEKFCH 348
            |.......|:....|              .|...:|.  .||..:|   .:::   :.::|    
Human   182 GYVLQQGIVKSPLAG--------------DFISMQCRELFQEMAIDIIPPYMIAAKEPVRE---- 228

  Fly   349 LNASVCGAQ---EKHFNLRKHNGQWLRY------------TIQVG----DEALMAPLALFHTELL 394
                  ||.   :|...|.:.:..|..|            .:||.    ||.:.|.:...|.|:.
Human   229 ------GAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMP 287

  Fly   395 NITGRTKAVFTQQAVQDQYDCEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADD 459
            |            .....|..|.....|.|.:.....|:.|..:|                    
Human   288 N------------GYNTDYGAERLRIPEGLFDPSNVKGLSGNTML-------------------- 320

  Fly   460 EELIVVDQDETISNCQSQLGAQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSSYETKRKMF 524
                                                |.|.|      :..||. :...:.:..::
Human   321 ------------------------------------GVGHV------VTTSIG-MCDIDIRPGLY 342

  Fly   525 GSILLVGSSAKLPGLAAWLEQRISQQVQSEVNVLI----KGMDAGMVAWKGAAIMSVLESARELW 585
            ||:::.|.:..|.|....|.:.:||:....:.:.:    ..|:.....|.|.:|::.|.:.:::|
Human   343 GSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMW 407

  Fly   586 ISQNDWQRHGLRVLRERSP 604
            ||:.:::..|.:.:..:.|
Human   408 ISKQEYEEGGKQCVERKCP 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 71/406 (17%)
ACTL6BNP_057272.1 Actin 11..426 CDD:394979 71/407 (17%)
Essential for mediating its function in dendritic development, may contribute to neuronal-specific targeting. /evidence=ECO:0000250|UniProtKB:Q99MR0 39..82
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.