DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and actr3

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001003944.1 Gene:actr3 / 406250 ZFINID:ZDB-GENE-040428-2 Length:418 Species:Danio rerio


Alignment Length:550 Identity:103/550 - (18%)
Similarity:172/550 - (31%) Gaps:191/550 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LQHCVVD---NKNRLRVA--TPPQQLAHFNRSSQAEKVPAPSGQMADEPWLDREAPVLFDDRILR 166
            |..||||   ...:|..|  |.||.:.   .|..|.|..|..|..|     .|......||....
Zfish     5 LPACVVDCGTGYTKLGYAGNTEPQFII---PSCIAIKESAKVGDQA-----QRRMMKGVDDLDFY 61

  Fly   167 LG--AVDARNYDIHFPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKIPLRKLGTHCAVL 229
            :|  |:|...|...:||:.|.:    |....::..|:.:  |:.|...|.        ..|..:|
Zfish    62 IGDEAIDKPTYATKWPIRHGIV----EDWDLMERFMEQV--IFKYLRAEP--------EDHYFLL 112

  Fly   230 V---VNDVYVRRHLREFVTLLLRRLGFRRCFLVQDSV----ASTFGAGIG----YGCVVDIGAQK 283
            .   :|....|.:..|   ::.........::...:|    ||.....:|    .|.|:|.|...
Zfish   113 TEPPLNTPENREYTAE---IMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGV 174

  Fly   284 TSIACIEDGISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECNV--QESYVDAHLLDELKEKF 346
            |.:..:.:|.........:...|.|:......|||:     ||..:  ::|...|   ..:||:|
Zfish   175 THVIPVAEGYVIGSCIKHIPIAGRDITYFTQQLLRE-----REVGIPPEQSLETA---KAVKERF 231

  Fly   347 CHLNASVCGAQEKHFNLRKHNG-QWLR------------YTIQVGDEALMAPLALFHTELLNITG 398
            .:    ||....|.|:....:| :|::            :||.||.|..:.|...||.|..|   
Zfish   232 SY----VCPDLVKEFSKYDTDGSKWIKQYTGINTISKKEFTIDVGYERFLGPEIFFHPEFAN--- 289

  Fly   399 RTKAVFTQQAVQDQYDCEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELI 463
               ..|||                                               |::    |::
Zfish   290 ---PDFTQ-----------------------------------------------PIS----EVV 300

  Fly   464 VVDQDETISNCQSQLGAQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSIL 528
                ||.|.||                           |:|              .:|.::.:|:
Zfish   301 ----DEVIQNC---------------------------PID--------------VRRPLYKNIV 320

  Fly   529 LVGSSAKLPGLAAWLEQRISQQVQS------------------EVNVLIKGMDAGMVAWKGAAIM 575
            |.|.|.........|::.:.:.|.:                  :|.|:...|....| |.|.:::
Zfish   321 LSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGKLKPKPIDVQVITHHMQRYAV-WFGGSML 384

  Fly   576 SVLESARELWISQNDWQRHGLRVLRERSPF 605
            :......::..::.|::..|..:.|....|
Zfish   385 ASTPEFYQVCHTKKDYEEIGPSICRHNPVF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 74/444 (17%)
actr3NP_001003944.1 PTZ00280 2..417 CDD:240343 102/549 (19%)
COG5277 6..410 CDD:227602 100/543 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.