DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and Arp3

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001261559.1 Gene:Arp3 / 38898 FlyBaseID:FBgn0262716 Length:418 Species:Drosophila melanogaster


Alignment Length:366 Identity:60/366 - (16%)
Similarity:111/366 - (30%) Gaps:150/366 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 GCVVDIGAQKTSIACIEDGISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECNV--QESYVDA 336
            |.|||.|...|.:..:.:|.........:...|.::...:..|||:     ||..:  ::|...|
  Fly   165 GIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLRE-----REVGIPPEQSLETA 224

  Fly   337 HLLDELKEKFCHLNASVCGAQEKHFNLRKHN---GQWLR------------YTIQVGDEALMAPL 386
               ..:|||.|:    :|....|.|  .|::   |:|:|            :.:.||.|..:.|.
  Fly   225 ---KAIKEKHCY----ICPDIAKEF--AKYDTEPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPE 280

  Fly   387 ALFHTELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRP 451
            ..||.|..|                                                     |..
  Fly   281 IFFHPEFSN-----------------------------------------------------PDF 292

  Fly   452 QLPVTADDEELIVVDQDETISNCQSQLGAQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSS 516
            .:|::    |::    |..|.||                           |:|            
  Fly   293 TIPLS----EIV----DNVIQNC---------------------------PID------------ 310

  Fly   517 YETKRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQ---------SEVNVLIKGMDAGMV----- 567
              .:|.::.:|:|.|.|.........|::.|.:.|.         ||..:..|.:|..::     
  Fly   311 --VRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQ 373

  Fly   568 ---AWKGAAIMSVLESARELWISQNDWQRHGLRVLRERSPF 605
               .|.|.::::......::..::..::.:|..:.|....|
  Fly   374 RYAVWFGGSMLASTPEFYQVCHTKAAYEEYGPSICRHNPVF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 59/362 (16%)
Arp3NP_001261559.1 PTZ00280 2..417 CDD:240343 60/366 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.