DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and POTEC

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001131143.1 Gene:POTEC / 388468 HGNCID:33894 Length:542 Species:Homo sapiens


Alignment Length:448 Identity:84/448 - (18%)
Similarity:140/448 - (31%) Gaps:157/448 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LDNVNSNSGLMVEFEEQRLVVSRILQHCVVDNKNRLRVATPPQQLAHFNRSSQAEKVPAPSGQMA 147
            |.:.|.||      |..:|::.|..|..|:|||.|..:.          ::.|.::         
Human   179 LASANGNS------EVVQLLLDRRCQLNVLDNKKRTALI----------KAVQCQE--------- 218

  Fly   148 DEPWLDREAPVLFDDRILRL---GAVDARNYDIHFPIQRGELN----VHNEKGGSLQASMQHLER 205
                         |:.:|.|   ||      |.:.|.:.|...    ||||.....:|.:     
Human   219 -------------DECVLMLLEHGA------DQNIPDEYGNTTLHYAVHNEDKLMAKALL----- 259

  Fly   206 IWSYALEERLKIPLRK--LGTHCAVLVVNDVYVRRHLREFVTLLLRRLGFRRCFLVQDSVASTFG 268
            ::...:|.:.|..|..  ||.|            ...::.|..|:::             .:...
Human   260 LYGADIESKNKCGLTPLLLGVH------------EQKQQVVKFLIKK-------------KANLN 299

  Fly   269 AGIGYGCVVDIGAQKTSIACIEDGISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECNV-QES 332
            |...||....|    .::.|....|..|.....:.....||.          |...||..| ...
Human   300 ALDRYGRTALI----LAVCCGSASIVNLLLEQNVDVSSQDLS----------GQTAREYAVSSHH 350

  Fly   333 YVDAHLLDELKEKFCHLNASVCGAQEKHFNLRKHNG---QWLRYTIQVGDEALMAPLALFHTELL 394
            :|...||.:.|||             :...:...|.   |.|:.|.:.            .::.|
Human   351 HVICELLSDYKEK-------------QMLKISSENSNPEQDLKLTSEE------------ESQRL 390

  Fly   395 NITGRTKAVFTQQAVQDQYDCEDCFDAEYLKETGRK---------NGV---RGGDILQLSTSAGY 447
            .::..::.....|..:...||:...:.| :|:.|..         ||.   .|.|.|.....:..
Human   391 KVSENSQPEKMSQEPEINKDCDREVEEE-IKKHGSNPVGLPENLTNGASAGNGDDGLIPQRRSRK 454

  Fly   448 QPRPQLPVTAD----------------DEELIVVDQDETISNCQSQLGAQTAGGQMNS 489
            ....|.|.|.:                :|:...:.|||.::|.|.|:  :.|..:|||
Human   455 PENQQFPDTENEEYHSDEQNDTRKQLSEEQNTGISQDEILTNKQKQI--EVAEKKMNS 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 57/322 (18%)
POTECNP_001131143.1 ANK 1 138..171
Ank_4 143..193 CDD:290365 6/19 (32%)
ANK 167..292 CDD:238125 34/173 (20%)
ANK 2 172..201 8/27 (30%)
ANK repeat 174..203 CDD:293786 9/29 (31%)
Ank_2 177..269 CDD:289560 28/138 (20%)
ANK repeat 205..236 CDD:293786 9/68 (13%)
ANK 3 205..234 9/66 (14%)
ANK 233..357 CDD:238125 29/167 (17%)
ANK repeat 238..269 CDD:293786 7/35 (20%)
ANK 4 238..267 6/33 (18%)
Ank_2 243..335 CDD:289560 20/125 (16%)
ANK repeat 271..302 CDD:293786 7/55 (13%)
ANK 5 271..300 6/53 (11%)
ANK repeat 304..335 CDD:293786 6/34 (18%)
ANK 6 304..333 6/32 (19%)
ANK 7 337..373 10/58 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 369..494 23/137 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.