DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and POTED

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_778146.2 Gene:POTED / 317754 HGNCID:23822 Length:584 Species:Homo sapiens


Alignment Length:484 Identity:90/484 - (18%)
Similarity:156/484 - (32%) Gaps:160/484 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LDNVNSNSGLMVEFEEQRLVVSRILQHCVVDNKNRLRVATPPQQLAHFNRSSQAEKVPAPSGQMA 147
            |.:.|.||      |..:|::.|..|..|:|||.|..:.          ::.|.::         
Human   179 LASANGNS------EVVQLLLDRRCQLNVLDNKKRTALI----------KAIQCQE--------- 218

  Fly   148 DEPWLDREAPVLFDDRILRL---GAVDARNYDIHFPIQRGELNVH----NEKGGSLQASMQHLER 205
                         |:.:|.|   ||      |.:.|.:.|...:|    ||.....:|.:     
Human   219 -------------DECVLMLLEHGA------DRNIPDEYGNTALHYAIYNEDKLMAKALL----- 259

  Fly   206 IWSYALEERLKIPLRK--LGTHCAVLVVNDVYVRRHLREFVTLLLRRLGFRRCFLVQDSVASTFG 268
            ::...:|.:.|..|..  ||.|            ...::.|..|:::   :....|.|....|  
Human   260 LYGADIESKNKCGLTPLLLGVH------------EQKQQVVKFLIKK---KANLNVLDRYGRT-- 307

  Fly   269 AGIGYGCVVDIGAQKTSIACIEDGISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECNV-QES 332
                        |...::.|....|..|.....:.....||.          |...||..| ...
Human   308 ------------ALILAVCCGSASIVNLLLEQNVDVSSQDLS----------GQTAREYAVSSHH 350

  Fly   333 YVDAHLLDELKEKFCHLNASVCGAQEKHFNLRKHNG---QWLRYTIQVGDEALMAPLALFHTELL 394
            :|...||.:.|||             :...:...|.   |.|:.|.:.            .::.|
Human   351 HVICELLSDYKEK-------------QMLKISSENSNPEQDLKLTSEE------------ESQRL 390

  Fly   395 NITGRTKAVFTQQAVQDQYDCEDCFDAEYLKETGRK---------NGV---RGGDILQLSTSAGY 447
            .::..::.....|..:...||:...:.| :|:.|..         ||.   .|.|.|.....:..
Human   391 KVSENSQPEKMSQEPEINKDCDREVEEE-IKKHGSNPVGLPENLTNGASAGNGDDGLIPQRRSRK 454

  Fly   448 QPRPQLPVTAD----------------DEELIVVDQDETISNCQSQLGAQTAGGQMNSNGCYHNG 496
            ....|.|.|.:                :|:...:.|||.::|.|.|:  :.|..:|||.....:.
Human   455 PENQQFPDTENEEYHSDEQNDTRKQLSEEQNTGISQDEILTNKQKQI--EVAEQKMNSELSLSHK 517

  Fly   497 QGLVLPLDQAIIQ---SINRLSSYETKRK 522
            :...|..:.:::|   ::.||...|||.:
Human   518 KEEDLLRENSVLQEEIAMLRLELDETKHQ 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 64/358 (18%)
POTEDNP_778146.2 Ank_4 143..193 CDD:290365 6/19 (32%)
ANK 167..292 CDD:238125 33/173 (19%)
ANK 1 172..201 8/27 (30%)
ANK repeat 174..203 CDD:293786 9/29 (31%)
Ank_2 177..269 CDD:289560 27/138 (20%)
ANK repeat 205..236 CDD:293786 9/68 (13%)
ANK 2 205..234 9/66 (14%)
ANK 233..357 CDD:238125 28/167 (17%)
ANK repeat 238..269 CDD:293786 6/35 (17%)
ANK 3 238..267 5/33 (15%)
Ank_2 243..335 CDD:289560 19/125 (15%)
ANK repeat 271..302 CDD:293786 7/45 (16%)
ANK 4 271..300 6/43 (14%)
ANK repeat 304..335 CDD:293786 5/44 (11%)
ANK 5 304..333 5/42 (12%)
ANK 6 337..366 10/51 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 369..502 26/147 (18%)
SH3_and_anchor <440..556 CDD:275056 24/109 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.