DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and Actrt1

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001013983.1 Gene:Actrt1 / 302796 RGDID:1359559 Length:376 Species:Rattus norvegicus


Alignment Length:449 Identity:83/449 - (18%)
Similarity:142/449 - (31%) Gaps:161/449 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 YD---IHFPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKIPLRKLGTHCAVLVVNDVYV 236
            ||   :|:||:||           |......:|::|....|..|.:...:.    .|.:......
  Rat    66 YDGLYLHYPIERG-----------LVTRWDDMEKLWKDLFEWELGVKPNEQ----PVFMTEPSLN 115

  Fly   237 RRHLREFVT-LLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIEDGISQLDARV 300
            .|..||..| ::..:......:|...:|.:...:....|.|:|.|...|....|.:|.|...|..
  Rat   116 PRETREKTTEIMFEKFNVPALYLCNHAVGALCASACITGLVLDSGDGVTCTVPIYEGYSLPRAIT 180

  Fly   301 RLSYGGGDLDQVLLLLLRKCGFPYRECNVQESYVDAHLLDELKEKFCHL-----NASVCGAQE-K 359
            :|...|.|:.:.|..||...|:.: .|.:.::.|     |::|||.|.:     ::..|..:. .
  Rat   181 KLYVAGRDITEHLTRLLLAKGYTF-PCILNKAVV-----DDIKEKLCTVSWGSKDSEKCYQRSLS 239

  Fly   360 HFNLRKHNGQWLRYTIQVGDEALMAPLALFHTELLNI--TGRTKAVFTQQAVQDQYDCEDCFDAE 422
            .:.|...|      |||:.|.....|..||..|.|.|  .|.:|.|                   
  Rat   240 EYKLPDGN------TIQMSDHLCQVPEVLFTPEHLGIHDLGISKMV------------------- 279

  Fly   423 YLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQSQLGAQTAGGQM 487
                                                               |.|.:...|     
  Rat   280 ---------------------------------------------------CNSIMKCDT----- 288

  Fly   488 NSNGCYHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQ 552
                                          :.:..:|..|:|.|.:...|||        ..::.
  Rat   289 ------------------------------DIQENLFAEIVLSGGTTLFPGL--------QDRLL 315

  Fly   553 SEVNVL------IK---GMDAGMVAWKGAAIMSVLESARELWISQNDWQRHGLRVLRER 602
            .|:.||      ||   ..|....||.|.::|:.|.:.:::|::..|::.:|..|::.:
  Rat   316 KELEVLAFEGTPIKITASPDRCYSAWIGGSVMTSLTTFKQMWVTAEDFKEYGAFVVQRK 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 75/419 (18%)
Actrt1NP_001013983.1 ACTIN 9..376 CDD:214592 83/449 (18%)
NBD_sugar-kinase_HSP70_actin 11..376 CDD:302596 83/449 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.