DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and Actr10

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001009602.1 Gene:Actr10 / 299121 RGDID:1306515 Length:417 Species:Rattus norvegicus


Alignment Length:447 Identity:77/447 - (17%)
Similarity:147/447 - (32%) Gaps:179/447 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKI---------PLRKLGTHCAVLVVNDVY 235
            ||:..:.|::.|:             ::|| |:|.:.|         |..:     .|:|:..|.
  Rat    51 PIKVVQYNINTEE-------------LYSY-LKEFIHILYFRHLLVNPRDR-----RVVVIESVL 96

  Fly   236 VRRHLREFVT-LLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIEDGISQLDAR 299
            ...|.||.:| :|.:........|....:.:....||....|:|.|.:::.:..|.:||..|:..
  Rat    97 CPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCW 161

  Fly   300 VRLSYGGGDLDQVL-LLLLRKC----------GFPYRECNVQESYVDAHLLDELKEKFCHLNASV 353
            ..|..||..|.:.| ..||.:|          ..|....:|.||     :|:::|.:.|.::...
  Rat   162 GALPLGGKALHKELETQLLEQCTVDTGAAKGQSLPSVMGSVPES-----VLEDIKVRTCFVSDLQ 221

  Fly   354 CGAQEKHFNLRKHNGQWLRYTIQVGDEALMAP----LALFHTELLNITGRTKAVFTQQAVQDQYD 414
            .|.|.          |..::.|...:|....|    ..|...::|::.|         :::|.. 
  Rat   222 RGLQI----------QAAKFNIDGNNERPSPPPNVDYPLDGEKILHVLG---------SIRDSV- 266

  Fly   415 CEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEE----LIVVDQDETISNCQ 475
                  .|.|.|                              .|:||    .:::|   ::..| 
  Rat   267 ------VEILFE------------------------------QDNEEKSVATLILD---SLLQC- 291

  Fly   476 SQLGAQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLA 540
                                      |:|              |::::..:::::|.::.|||..
  Rat   292 --------------------------PVD--------------TRKQLAENLVIIGGTSMLPGFL 316

  Fly   541 AWLEQRISQQVQSEVNVLIK------------------GMDAGMVAWKGAAIMSVLE 579
                    .::.:|:..|::                  ...|..|||.|.|:...|:
  Rat   317 --------HRLLAEIRYLVEKPKYKKTLGTKNFRIHTPPAKANCVAWLGGAVFGALQ 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 73/425 (17%)
Actr10NP_001009602.1 NBD_sugar-kinase_HSP70_actin 13..364 CDD:418402 76/444 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.