DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and Actrt2

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001013959.1 Gene:Actrt2 / 298671 RGDID:1359657 Length:377 Species:Rattus norvegicus


Alignment Length:472 Identity:93/472 - (19%)
Similarity:160/472 - (33%) Gaps:153/472 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 APSGQMADEPWLDREAPVLFDDRILRLGAVDARNYDIHFPIQRGELNVHNEKGGSLQASMQHLER 205
            :|:|....:.::..||  ||....|||.:          ||:||           |..|...:|:
  Rat    47 SPTGACQKKYFVGEEA--LFKQETLRLQS----------PIERG-----------LITSWDDIEK 88

  Fly   206 IWSYALEERLKIPLRKLGTHCAVLVVNDVYVRRHLREFVTLLLRRLGFRRCFLVQDSVASTFGAG 270
            :|.:..|..|.:   |......::....:..|.:..:...::.........:|...:|.:.:.:.
  Rat    89 LWRHLFEWELGV---KPSERPVLMTEPSLNPRENREKTAEVMFETFEVPAFYLSDQAVLALYSSA 150

  Fly   271 IGYGCVVDIGAQKTSIACIEDGISQLDARVRLSYGGGDLDQVLLLLLRKCG--FPYRECNVQESY 333
            ...|.|||.|...|....|.:|.|...|..:|...|.|:.::|..||...|  ||   |.     
  Rat   151 CVTGLVVDSGDGVTCTVPIFEGYSLPHAVSKLFVAGKDITELLTRLLLASGRAFP---CP----- 207

  Fly   334 VDAHLLDELKEKFCHLNASVCGAQEKHFNLRKHNGQWLR-------YTIQVGDEALMAPLALFHT 391
            :|..|:|::|||.|::      |.|....|.:.....||       ..|.:||:...||..||..
  Rat   208 LDKALVDDIKEKLCYV------ALEPEEELSRRAEDVLREYKLPDGNVIYIGDQLYQAPEVLFSP 266

  Fly   392 ELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVT 456
            :.|                                     |..|..:.|::::            
  Rat   267 DQL-------------------------------------GTHGPGLAQMASN------------ 282

  Fly   457 ADDEELIVVDQDETISNCQSQLGAQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSSYETKR 521
                         :|:.|.:.:                                         ::
  Rat   283 -------------SIAKCDADI-----------------------------------------QK 293

  Fly   522 KMFGSILLVGSSAKLPGLAAWLEQRISQQVQSEVNVLIKG-MDAGMVAWKGAAIMSVLESARELW 585
            .:||.|:|.|.|....||...|.:.:.|.....|.:.|.. .|.....|.||:|::.|.|.:::|
  Rat   294 TLFGEIVLSGGSTLFQGLDDRLLKELEQLASKGVPIKITAPPDRWFSTWIGASIVTSLSSFKQMW 358

  Fly   586 ISQNDWQRHGLRVLRER 602
            |:..|::..|:.|::.|
  Rat   359 ITAADFKEFGVSVVQRR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 78/411 (19%)
Actrt2NP_001013959.1 NBD_sugar-kinase_HSP70_actin 6..377 CDD:302596 93/472 (20%)
ACTIN 10..377 CDD:214592 93/472 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.