DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and Actbl2

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001099879.1 Gene:Actbl2 / 294732 RGDID:1309504 Length:376 Species:Rattus norvegicus


Alignment Length:436 Identity:67/436 - (15%)
Similarity:146/436 - (33%) Gaps:139/436 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 IHFPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKIPLRKLGTHCAVLVVNDVYVRRHLR 241
            :.:||:.|           :..:...:|:||.:.....|::...:   |..:|....:..:.:..
  Rat    68 LKYPIEHG-----------VVTNWDDMEKIWYHTFYNELRVAPDE---HPILLTEAPLNPKINRE 118

  Fly   242 EFVTLLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIEDGISQLDARVRLSYGG 306
            :...::.........::...:|.|.:.:|...|.|:|.|...|....|.:|.:.....:||...|
  Rat   119 KMTQIMFEAFNTPAMYVAIQAVLSLYASGRTTGNVMDSGDGVTHTVPIYEGYALPHGILRLDLAG 183

  Fly   307 GDLDQVLLLLLRKCGFPYRECNVQESYVDAHLLDELKEKFCH---------LNASVCGAQEKHFN 362
            .||...|:.:|.:.|:.:      .:..:..::.::|||.|:         :.|:...:.|:.:.
  Rat   184 RDLTDYLMKILTERGYNF------TTTAEREIVRDVKEKLCYVALDFEQEMVTAAASSSLERSYE 242

  Fly   363 LRKHNGQWLRYTIQVGDEALMAPLALFHTELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYLKET 427
            |  .:||    .|.:|:|....|.|:|....|.|..|                            
  Rat   243 L--PDGQ----VITIGNERFRCPEAIFQPSFLGIESR---------------------------- 273

  Fly   428 GRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQSQLGAQTAGGQMNSNGC 492
                |:.                                  ||..|.                  
  Rat   274 ----GIH----------------------------------ETTFNS------------------ 282

  Fly   493 YHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQSEVNV 557
                   ::..|            .:.::.::.:.:|.|.|...||:|..:::.|.....|.:.:
  Rat   283 -------IMKCD------------VDIRKDLYANTVLSGGSTMYPGIADRMQKEIVTLAPSTMKI 328

  Fly   558 -LIKGMDAGMVAWKGAAIMSVLESARELWISQNDWQRHGLRVLRER 602
             :|...:.....|.|.:|::.|.:.:::|||:.::...|..::..:
  Rat   329 KIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPPIVHRK 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 64/411 (16%)
Actbl2NP_001099879.1 NBD_sugar-kinase_HSP70_actin 1..376 CDD:302596 67/436 (15%)
ACTIN 8..376 CDD:214592 67/436 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.