DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and ACTRT1

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_612146.1 Gene:ACTRT1 / 139741 HGNCID:24027 Length:376 Species:Homo sapiens


Alignment Length:525 Identity:109/525 - (20%)
Similarity:179/525 - (34%) Gaps:204/525 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RLVVSRILQHCVVDNKNRLRVATPPQQLAHFNRSSQAEKVPAPSGQMADEPWLDREAPVLFDDRI 164
            |.|:|.:|.||                           |...|..::..:.::.:||  |:....
Human    32 RHVISSVLGHC---------------------------KFNVPLARLNQKYFVGQEA--LYKYEA 67

  Fly   165 LRLGAVDARNYDIHFPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKIPLRKLG---THC 226
            |.|          |:||:||           |......:|::|.:..|       |:||   :..
Human    68 LHL----------HYPIERG-----------LVTGWDDMEKLWKHLFE-------RELGVKPSQQ 104

  Fly   227 AVLV----VNDVYVRRHLREFVTLLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIA 287
            .||:    :|...:|..|.|.:.......||   :|...:||:.:.:....|.|||.|...|...
Human   105 PVLMTEPSLNPREIREKLAEMMFETFSVPGF---YLSNHAVAALYASACVTGLVVDSGDGVTCTV 166

  Fly   288 CIEDGISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECNVQESYVDAHLLDELKEKFCHLNAS 352
            .|.:|.|...|..:|...|.|:.:.|..||...||.: .|.:.::.|     :.:|||.|::   
Human   167 PIFEGYSLPHAVTKLCMAGRDITEHLTRLLFASGFNF-PCILNKAVV-----NNIKEKLCYI--- 222

  Fly   353 VCGAQEKHFNLRKHNGQWL-------RYTIQVGDEALMAPLALFHTELLNITGRTKAVFTQQAVQ 410
               |.|....|||..|:.|       .:.|..|||....|..||                     
Human   223 ---ALEPEKELRKSRGEVLGAYRLPDGHVIHFGDELYQVPEVLF--------------------- 263

  Fly   411 DQYDCEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQ 475
                                                          |.|                
Human   264 ----------------------------------------------APD---------------- 266

  Fly   476 SQLGAQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLA 540
             |||..:.|                  |.:.:..||.:..: :.:.|::..|:|.|.:..|||  
Human   267 -QLGIHSPG------------------LSKMVSSSIMKCDT-DIQNKLYADIVLSGGTTLLPG-- 309

  Fly   541 AWLEQRISQQVQSEVNVLIKGM--------DAGMVAWKGAAIMSVLESARELWISQNDWQRHGLR 597
              ||:|:.::|:   .:..||.        |....||.||:||:.:.|.:::|::..|::.:|..
Human   310 --LEERLMKEVE---QLASKGTPIKITASPDRCFSAWIGASIMTSMSSFKQMWVTSADFKEYGTS 369

  Fly   598 VLRER 602
            |::.|
Human   370 VVQRR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 90/423 (21%)
ACTRT1NP_612146.1 ACTIN 9..376 CDD:214592 109/525 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.