DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and ACTL7A

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_006678.1 Gene:ACTL7A / 10881 HGNCID:161 Length:435 Species:Homo sapiens


Alignment Length:469 Identity:89/469 - (18%)
Similarity:165/469 - (35%) Gaps:142/469 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 VPAPSGQMA---DEPWLDREAPVLFDDRILRLGAVDARNYDIHF----PIQRGELNVHNEKGGSL 196
            :|.|:.:::   .:|::  |.....|:|.......:..|.::|.    |::.|           :
Human    88 LPRPTHKISTTVGKPYM--ETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHG-----------I 139

  Fly   197 QASMQHLERIWSYALEERLKIPLRKLGTHCAVLVVNDVYVRRHL--REFVTLLLRRLGFRRCFLV 259
            ......::.||.|...:.:||...:   | ||| |:|..:..|.  .::..:|..........:.
Human   140 IVDWDTVQDIWEYLFRQEMKIAPEE---H-AVL-VSDPPLSPHTNREKYAEMLFEAFNTPAMHIA 199

  Fly   260 QDSVASTFGAGIGYGCVVDIGAQKTSIACIEDGISQLDARVRLSYGGGDLDQVLLLLLRKCGFPY 324
            ..|..|.:..|...|.||::|...:.:..|.:|........||.|.|.||...||.||...|..:
Human   200 YQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAGNEF 264

  Fly   325 RECNVQESYVDAHLLDELKEKFCHLNASVCGAQEKHFNLRKHNGQWLRYTIQVGDEALMAPLALF 389
            .:..:       .:::::|:|.|.:  ::...:||...|.:|.   :||.:..|.|.        
Human   265 TQDQM-------GIVEDIKKKCCFV--ALDPIEEKKVPLSEHT---IRYVLPDGKEI-------- 309

  Fly   390 HTELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLP 454
                             |..|:::.|.:.|                           ::|     
Human   310 -----------------QLCQERFLCSEMF---------------------------FKP----- 325

  Fly   455 VTADDEELIVVDQDETISNCQSQLGAQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSSYET 519
                          ..|.:.|..|..||                         :..:|: .....
Human   326 --------------SLIKSMQLGLHTQT-------------------------VSCLNK-CDIAL 350

  Fly   520 KRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQS---EVNVLIKGMDAGMVAWKGAAIMSVLESA 581
            ||.:.|:|||.|.|..|.|....|::.:|....:   :||||   .:.....|.|.:|::.|:..
Human   351 KRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDTPQVNVL---PERDSAVWTGGSILASLQGF 412

  Fly   582 RELWISQNDWQRHG 595
            :.||:.:.:::.||
Human   413 QPLWVHRFEYEEHG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 79/399 (20%)
ACTL7ANP_006678.1 ACTL7A_N 1..65 CDD:293445
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64
Required for interaction with TES 31..51
NBD_sugar-kinase_HSP70_actin 67..435 CDD:302596 89/469 (19%)
ACTIN 69..435 CDD:214592 89/469 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.