DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and POTEB3

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_997238.2 Gene:POTEB3 / 102724631 HGNCID:51240 Length:581 Species:Homo sapiens


Alignment Length:464 Identity:88/464 - (18%)
Similarity:150/464 - (32%) Gaps:162/464 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 KIPLRKLGTHCAVLVVNDVYVRR---------HL------REFVTLLLRRLGFRRCFL-VQDSVA 264
            |:|.:.|     ::::.|..:.:         ||      .|.|.|||.    |||.| |.|:..
Human   151 KVPRKDL-----IVMLRDTDMNKRDKQKRTALHLASANGNSEVVQLLLD----RRCQLNVLDNKK 206

  Fly   265 STFGAGIGYGCVVDIGAQKTSIACIEDGISQL------DARVRLSYGGGDL-------DQVL--- 313
            .|              |...::.|.||....:      |..::..||...|       |:::   
Human   207 RT--------------ALIKAVQCQEDECVLMLLEHGADGNIQDEYGNTALHYAIYNEDKLMAKA 257

  Fly   314 LLLL-------RKCGFPYRECNVQESYVDAHLLDELKEKFCHLNA-----------SVCGAQEKH 360
            |||.       .|||.......|.|.  ...::..|.:|..:|||           :||......
Human   258 LLLYGADIESKNKCGLTPLLLGVHEQ--KQQVVKFLIKKKANLNALDRYGRTALILAVCCGSASI 320

  Fly   361 FNL----------RKHNGQWLR-YTIQVGDEALMAPLALF------------------------- 389
            .||          :..:||..| |.:......:...|:.:                         
Human   321 VNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVICELLSDYKEKQMLKISSENSNPEQDLKLTSEE 385

  Fly   390 HTELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYLKETGRK---------NGV---RGGDILQLS 442
            .::.|.::..::.....|..:...||:...:.| :|:.|..         ||.   .|.|.|...
Human   386 ESQRLKVSENSQPEKMSQEPEINKDCDREVEEE-IKKHGSNPVGLPENLTNGASAGNGDDGLIPQ 449

  Fly   443 TSAGYQPRPQLPVTAD----------------DEELIVVDQDETISNCQSQLGAQTAGGQMNSN- 490
            ..:......|.|.|.:                :|:...:.|||.::|.|.|:  :.|..:|||. 
Human   450 RKSRKPENQQFPDTENEEYHSDEQNDTQKQLSEEQNTGISQDEILTNKQKQI--EVAEKEMNSKL 512

  Fly   491 GCYHNGQGLVLPLDQAIIQSIN--RLSSYETKRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQS 553
            ...|..:..:|..:..:.:.|.  ||...|||.:                 ....|.:|.::::|
Human   513 SLSHKKEEDLLRENSMLREEIAMLRLELDETKHQ-----------------NQLRENKILEEIES 560

  Fly   554 EVNVLIKGM 562
            ....|:|.:
Human   561 VKEKLLKAI 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 88/464 (19%)
POTEB3NP_997238.2 Ank_4 143..193 CDD:290365 9/46 (20%)
ANK 167..292 CDD:238125 31/144 (22%)
ANK 1. /evidence=ECO:0000255 172..201 11/32 (34%)
ANK repeat 174..203 CDD:293786 12/32 (38%)
Ank_2 177..269 CDD:289560 26/109 (24%)
ANK repeat 205..236 CDD:293786 6/44 (14%)
ANK 2. /evidence=ECO:0000255 205..234 6/42 (14%)
ANK 233..357 CDD:238125 25/125 (20%)
ANK repeat 238..269 CDD:293786 7/30 (23%)
ANK 3. /evidence=ECO:0000255 238..267 7/28 (25%)
Ank_2 243..335 CDD:289560 19/93 (20%)
ANK repeat 271..302 CDD:293786 9/32 (28%)
ANK 4. /evidence=ECO:0000255 271..300 7/30 (23%)
ANK repeat 304..335 CDD:293786 4/30 (13%)
ANK 5. /evidence=ECO:0000255 304..333 4/28 (14%)
ANK 6. /evidence=ECO:0000255 337..366 5/28 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 369..494 19/125 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.