DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and Acte1

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001356763.1 Gene:Acte1 / 102636989 MGIID:2685344 Length:382 Species:Mus musculus


Alignment Length:449 Identity:85/449 - (18%)
Similarity:155/449 - (34%) Gaps:143/449 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LGAVDARN---YDIHFPIQRGELNVHNEKGGSLQASMQHLERIWSYALEERLKIPLRKLGTHCAV 228
            :||....|   .::::||.||.:           .:..::|:||.|:....|:|...:   | .:
Mouse    62 IGAETQTNRTELNMYYPISRGAI-----------TNWDNVEKIWHYSFYHSLQIAPEQ---H-PI 111

  Fly   229 LVVNDVYVRRHLREFVT-LLLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIEDG 292
            |:.......:..:..:| :|.....|...:....:|.|...:|...|..::.|...|....:.:|
Mouse   112 LITEAPLTSKEAKSRMTQILFETFNFPALYTANQAVLSLIASGRTSGTAIESGDGMTYFVPVMNG 176

  Fly   293 ISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECNVQESYVDAHLLDELKEKFCH--------L 349
            .....:..:|...|.||...|:.||...|      ||.|:..|...:.:||:|:.:        :
Mouse   177 YPLHLSTTKLDIAGQDLTLYLMKLLSDNG------NVLETIADLEYIRDLKDKYSYVALDYNMEM 235

  Fly   350 NASVCGAQEKHFNLRKHNGQWLRYTIQVGDEALMAPLALFHTELLNITGRTKAVFTQQAVQDQYD 414
            :.:...:.:|.|.|  .:|:    .|.:|.||.|....||.|.||.                   
Mouse   236 SKTSAPSFQKKFTL--PDGK----EINLGQEAFMCSEVLFDTSLLE------------------- 275

  Fly   415 CEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQSQLG 479
                          |.|  .|..:|.|                           |:|.:|:..  
Mouse   276 --------------RAN--PGIHMLTL---------------------------ESIMSCEKS-- 295

  Fly   480 AQTAGGQMNSNGCYHNGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLAAWLE 544
                          |                         :|.:|..|:|.|.::...||...::
Mouse   296 --------------H-------------------------QRTLFNYIVLTGGTSACTGLRFRMQ 321

  Fly   545 QRISQQVQSEVNVLIKGMD-AGMVAWKGAAIMSVLESARELWISQNDWQRHGLRVLRER 602
            :.:::.|..:..|.:.... |...||.||:|:|.|...:::||:.:::...|..|:..|
Mouse   322 KEMAKVVSPDFCVKVTASPYAKYSAWIGASILSSLPLFKDMWITNHEYLEIGPSVIFRR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 78/411 (19%)
Acte1NP_001356763.1 NBD_sugar-kinase_HSP70_actin 2..382 CDD:354300 85/449 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.