Sequence 1: | NP_573251.1 | Gene: | Arp8 / 32769 | FlyBaseID: | FBgn0030877 | Length: | 607 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001264233.1 | Gene: | POTEB / 100996331 | HGNCID: | 33734 | Length: | 544 | Species: | Homo sapiens |
Alignment Length: | 344 | Identity: | 71/344 - (20%) |
---|---|---|---|
Similarity: | 118/344 - (34%) | Gaps: | 139/344 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 351 ASVC-----GAQEKHFNLRKHNGQWLRY---------TIQVG-----DEALMAPLALFHTELLNI 396
Fly 397 TGRTKAVFTQQAVQDQYDCEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADD-- 459
Fly 460 -------------EELIVVDQDETISNCQSQLGAQTAGGQMNSNGCYHNGQGLVLPLDQ------ 505
Fly 506 -------AIIQSIN----------------------------RLSSYETKRKMFGSILLVGS--- 532
Fly 533 SAKLPGLAAWLEQRISQQVQSEVNVLIK-----------GMDAGMVA--WKGAAIMSVL------ 578
Fly 579 --------ESARELWISQN 589 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Arp8 | NP_573251.1 | NBD_sugar-kinase_HSP70_actin | 202..603 | CDD:302596 | 71/344 (21%) |
POTEB | NP_001264233.1 | ANK | 130..255 | CDD:238125 | 23/130 (18%) |
ANK 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 135..167 | 9/36 (25%) | |||
ANK repeat | 137..166 | CDD:293786 | 8/31 (26%) | ||
ANK 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 168..200 | 2/31 (6%) | |||
ANK repeat | 168..199 | CDD:293786 | 2/30 (7%) | ||
ANK | 196..320 | CDD:238125 | 25/118 (21%) | ||
ANK 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 201..233 | 6/31 (19%) | |||
ANK repeat | 201..232 | CDD:293786 | 6/30 (20%) | ||
ANK 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 234..266 | 9/32 (28%) | |||
ANK repeat | 234..265 | CDD:293786 | 9/31 (29%) | ||
ANK 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00023 | 267..299 | 6/31 (19%) | |||
ANK repeat | 267..298 | CDD:293786 | 6/30 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 332..457 | ||||
SMC_N | <412..>542 | CDD:330553 | |||
CCDC144C | 489..>542 | CDD:317340 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5277 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |