DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp8 and Actl10

DIOPT Version :9

Sequence 1:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_003749645.1 Gene:Actl10 / 100911682 RGDID:6491130 Length:334 Species:Rattus norvegicus


Alignment Length:437 Identity:79/437 - (18%)
Similarity:137/437 - (31%) Gaps:144/437 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GELNVHNEKGGSLQASMQHLERIWSYALEERLKI-PLRKLGTHCAVLVVNDVYVRRHLREFVT-L 246
            |....|..|.| :......||.:|     |||.: .|:.......|||.:........||.|. |
  Rat    20 GVARAHPIKHG-VVVDWDALEGLW-----ERLMVGGLQIHPEQWPVLVSDSPSAPPEGREKVAEL 78

  Fly   247 LLRRLGFRRCFLVQDSVASTFGAGIGYGCVVDIGAQKTSIACIEDGISQLDARVRLSYGGGDLDQ 311
            |...|....|.:...::.:....|...|..|:.||.......|..|.|...|..||:..|..|.:
  Rat    79 LFEALTVPACHMASTALLALCSVGAFSGLAVEAGAGVCHATPIYAGHSWHKATFRLNVAGSTLSR 143

  Fly   312 VLL-LLLRKCGFPYRECNVQESYVDAHLLDELKEKFCHLN----ASVCGA---QEKHFNLRKHNG 368
            ... ||:..|.      ::|...:....:.:||::.|:::    ..:|..   |...|.|.|  |
  Rat   144 YFRDLLVASCP------DLQLHALPRKTVTQLKKRCCYVSLDFQGDICDPARHQRACFCLGK--G 200

  Fly   369 QWLRYTIQVGDEALMAPLALFHTELLNITGRTKAVFTQQAVQDQYDCEDCFDAEYLKETGRKNGV 433
            .::|    :|.|....|..:|...||.                                      
  Rat   201 CYVR----LGSERFRCPEPIFQPSLLG-------------------------------------- 223

  Fly   434 RGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDETISNCQSQLGAQTAGGQMNSNGCYHNGQG 498
                          .|.|.||..|                                         
  Rat   224 --------------HPEPGLPTLA----------------------------------------- 233

  Fly   499 LVLPLDQAIIQSINRLSSYETKRKMFGSILLVGSSAKLPGLAAWLEQRISQQVQSEVN------- 556
                     .|::.::.: ..:.::..:::|.|.|...||..    :|::.::|::..       
  Rat   234 ---------FQALQKIPT-TLRTRLANTVVLAGGSTLFPGFV----ERMNLELQAQCRRHGYPAL 284

  Fly   557 --VLIKGMDAGMVAWKGAAIMSVLESARELWISQNDWQRHGLRVLRE 601
              .|:.....|...|.|.::|:.|.|.:..|:::..:|.:|..::||
  Rat   285 QPCLVAHPGRGTAVWTGGSMMASLHSFQRRWMTRAMYQEYGPFLVRE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 75/419 (18%)
Actl10XP_003749645.1 NBD_sugar-kinase_HSP70_actin 25..329 CDD:302596 76/428 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.