DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6762 and SRX1

DIOPT Version :9

Sequence 1:NP_573250.1 Gene:CG6762 / 32768 FlyBaseID:FBgn0030876 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_012837.1 Gene:SRX1 / 853776 SGDID:S000001569 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:112 Identity:36/112 - (32%)
Similarity:61/112 - (54%) Gaps:22/112 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VPMSVIQRPIPSVLDEQKVQSLMETIKN---------------ETSEDEVPPIDLLWISGSEGGD 115
            :|:|.|:||:..|||.||:.:::.|:|.               ..|..|:||:|:|.:. .:|..
Yeast    13 IPLSEIRRPLAPVLDPQKIDAMVATMKGIPTASKTCSLEQAEAAASAGELPPVDVLGVR-VKGQT 76

  Fly   116 YYFSFGGCHRFEAYKRLQRPT------IKAKLVKSTLGDLYHYMGSS 156
            .|::||||||.:||.|..|.|      ::.:::.:|...:..|:|||
Yeast    77 LYYAFGGCHRLQAYDRRARETQNAAFPVRCRVLPATPRQIRMYLGSS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6762NP_573250.1 ParBc 53..156 CDD:295187 34/110 (31%)
SRX1NP_012837.1 COG5119 1..127 CDD:227449 36/112 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344383
Domainoid 1 1.000 60 1.000 Domainoid score I2565
eggNOG 1 0.900 - - E1_COG5119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I1741
Isobase 1 0.950 - 0 Normalized mean entropy S1909
OMA 1 1.010 - - QHG53061
OrthoFinder 1 1.000 - - FOG0006602
OrthoInspector 1 1.000 - - oto99104
orthoMCL 1 0.900 - - OOG6_105315
Panther 1 1.100 - - LDO PTHR21348
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1396
SonicParanoid 1 1.000 - - X4840
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.