DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6762 and Srxn1

DIOPT Version :9

Sequence 1:NP_573250.1 Gene:CG6762 / 32768 FlyBaseID:FBgn0030876 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_083964.2 Gene:Srxn1 / 76650 MGIID:104971 Length:155 Species:Mus musculus


Alignment Length:105 Identity:63/105 - (60%)
Similarity:81/105 - (77%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TVHSAGIDETHLVPMSVIQRPIPSVLDEQKVQSLMETIKNETSEDEVPPIDLLWISGSEGGDYYF 118
            ::||..|...|.||::|:.||:|||||..|||||::||.  ...|.|||||:|||.|::|||||:
Mouse    50 SIHSGCIATVHNVPIAVLIRPLPSVLDPAKVQSLVDTIL--ADPDSVPPIDVLWIKGAQGGDYYY 112

  Fly   119 SFGGCHRFEAYKRLQRPTIKAKLVKSTLGDLYHYMGSSAP 158
            |||||||:.||::|||.||.||||:|||.||..|:|:|.|
Mouse   113 SFGGCHRYAAYQQLQRETIPAKLVRSTLSDLRMYLGASTP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6762NP_573250.1 ParBc 53..156 CDD:295187 61/101 (60%)
Srxn1NP_083964.2 Srx 59..148 CDD:319253 57/90 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839568
Domainoid 1 1.000 106 1.000 Domainoid score I6618
eggNOG 1 0.900 - - E1_COG5119
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32722
Inparanoid 1 1.050 133 1.000 Inparanoid score I4590
Isobase 1 0.950 - 0 Normalized mean entropy S1909
OMA 1 1.010 - - QHG53061
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006602
OrthoInspector 1 1.000 - - oto92255
orthoMCL 1 0.900 - - OOG6_105315
Panther 1 1.100 - - LDO PTHR21348
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1396
SonicParanoid 1 1.000 - - X4840
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.