DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6762 and Srxn1

DIOPT Version :9

Sequence 1:NP_573250.1 Gene:CG6762 / 32768 FlyBaseID:FBgn0030876 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_001041323.3 Gene:Srxn1 / 296271 RGDID:1307332 Length:155 Species:Rattus norvegicus


Alignment Length:105 Identity:64/105 - (60%)
Similarity:83/105 - (79%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TVHSAGIDETHLVPMSVIQRPIPSVLDEQKVQSLMETIKNETSEDEVPPIDLLWISGSEGGDYYF 118
            ::||..||..|.||::|:.||:|||||..|||||::||..:  .|.|||||:|||.|::|||||:
  Rat    50 SIHSGCIDTVHNVPIAVLIRPLPSVLDPVKVQSLVDTILED--PDSVPPIDVLWIKGAQGGDYYY 112

  Fly   119 SFGGCHRFEAYKRLQRPTIKAKLVKSTLGDLYHYMGSSAP 158
            |||||||:.||::|||.||.||||:|||.||..|:|:|.|
  Rat   113 SFGGCHRYAAYQQLQRETIPAKLVRSTLSDLRMYLGASTP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6762NP_573250.1 ParBc 53..156 CDD:295187 62/101 (61%)
Srxn1NP_001041323.3 ParBc 50..150 CDD:295187 62/101 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32722
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.