DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6762 and srx1

DIOPT Version :9

Sequence 1:NP_573250.1 Gene:CG6762 / 32768 FlyBaseID:FBgn0030876 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_595151.1 Gene:srx1 / 2540069 PomBaseID:SPBC106.02c Length:124 Species:Schizosaccharomyces pombe


Alignment Length:121 Identity:49/121 - (40%)
Similarity:69/121 - (57%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TTVHSAGIDETHLVPMSVIQRPIPSVLDEQKVQSLMETIKNE--------TSED----EVPPIDL 105
            |::|:...:....:.||.:.||||.|||..||.|:|||:..:        ||||    |:||:|:
pombe     2 TSIHTGSNNNIVELDMSELIRPIPPVLDMNKVNSMMETMTGKTPPASCGLTSEDLEAGELPPVDV 66

  Fly   106 LWISGSEGGDYYFSFGGCHRFEAYKRLQRPTIKAKLVKSTLGDLYHYMGSSAPKYL 161
            |....| |..|||:||||||..|:....|..::.|||..:...|..|:|:||.|:|
pombe    67 LTFKKS-GKPYYFAFGGCHRLRAHDEAGRKKVRCKLVNCSPNTLRLYLGASANKFL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6762NP_573250.1 ParBc 53..156 CDD:295187 45/114 (39%)
srx1NP_595151.1 COG5119 2..124 CDD:227449 49/121 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2769
eggNOG 1 0.900 - - E1_COG5119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I1820
OMA 1 1.010 - - QHG53061
OrthoFinder 1 1.000 - - FOG0006602
OrthoInspector 1 1.000 - - oto100616
orthoMCL 1 0.900 - - OOG6_105315
Panther 1 1.100 - - LDO PTHR21348
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1396
SonicParanoid 1 1.000 - - X4840
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.