DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srx and SRXN1

DIOPT Version :10

Sequence 1:NP_573250.1 Gene:Srx / 32768 FlyBaseID:FBgn0030876 Length:162 Species:Drosophila melanogaster
Sequence 2:NP_542763.1 Gene:SRXN1 / 140809 HGNCID:16132 Length:137 Species:Homo sapiens


Alignment Length:105 Identity:63/105 - (60%)
Similarity:83/105 - (79%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TVHSAGIDETHLVPMSVIQRPIPSVLDEQKVQSLMETIKNETSEDEVPPIDLLWISGSEGGDYYF 118
            ::||..|...|.||:||:.||:|||||..|||||::||:.:  .|.|||||:|||.|::||||::
Human    32 SIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIRED--PDSVPPIDVLWIKGAQGGDYFY 94

  Fly   119 SFGGCHRFEAYKRLQRPTIKAKLVKSTLGDLYHYMGSSAP 158
            |||||||:.||::|||.||.||||:|||.||..|:|:|.|
Human    95 SFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SrxNP_573250.1 Srx 63..154 CDD:319253 57/90 (63%)
SRXN1NP_542763.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 0/1 (0%)
Srx 41..130 CDD:319253 57/90 (63%)

Return to query results.
Submit another query.