DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6762 and srxn1

DIOPT Version :9

Sequence 1:NP_573250.1 Gene:CG6762 / 32768 FlyBaseID:FBgn0030876 Length:162 Species:Drosophila melanogaster
Sequence 2:XP_002663173.1 Gene:srxn1 / 100331561 ZFINID:ZDB-GENE-091230-2 Length:140 Species:Danio rerio


Alignment Length:116 Identity:63/116 - (54%)
Similarity:85/116 - (73%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RYRSSCSTMDTTVHSAGIDETHLVPMSVIQRPIPSVLDEQKVQSLMETIKNETSEDEVPPIDLLW 107
            |...|.|:.:.::||..|.:.|.:||.||.||||.|||||||||||.:|:..:....|||||:||
Zfish    22 RNMGSLSSENRSIHSDNIQDVHNIPMGVIIRPIPPVLDEQKVQSLMTSIQECSDISVVPPIDVLW 86

  Fly   108 ISGSEGGDYYFSFGGCHRFEAYKRLQRPTIKAKLVKSTLGDLYHYMGSSAP 158
            |:|.:||:||:||||||||.||:||:..:|.||::||.:.||..|:|:|.|
Zfish    87 ITGEKGGNYYYSFGGCHRFAAYQRLKMKSIPAKIIKSNISDLRTYLGASTP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6762NP_573250.1 ParBc 53..156 CDD:295187 58/102 (57%)
srxn1XP_002663173.1 ParBc 33..135 CDD:295187 58/101 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583648
Domainoid 1 1.000 105 1.000 Domainoid score I6623
eggNOG 1 0.900 - - E1_COG5119
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32722
Inparanoid 1 1.050 136 1.000 Inparanoid score I4553
OMA 1 1.010 - - QHG53061
OrthoDB 1 1.010 - - D1421270at2759
OrthoFinder 1 1.000 - - FOG0006602
OrthoInspector 1 1.000 - - oto41305
orthoMCL 1 0.900 - - OOG6_105315
Panther 1 1.100 - - LDO PTHR21348
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1396
SonicParanoid 1 1.000 - - X4840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.