DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32554 and LAC10

DIOPT Version :10

Sequence 1:NP_728102.1 Gene:CG32554 / 32767 FlyBaseID:FBgn0052554 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_195739.2 Gene:LAC10 / 831697 AraportID:AT5G01190 Length:558 Species:Arabidopsis thaliana


Alignment Length:78 Identity:20/78 - (25%)
Similarity:26/78 - (33%) Gaps:35/78 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KVFQYRASDPN------ATKL----------VAIEPT---------------NEFTKRRRQNNWN 225
            :||.:....|:      ||||          |.::.|               |.|.......|:|
plant   415 RVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENHPIHLHGFNFFVVGLGTGNYN 479

  Fly   226 ESRISKKMSNKQN 238
                |||.|||.|
plant   480 ----SKKDSNKFN 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32554NP_728102.1 None
LAC10NP_195739.2 laccase 22..558 CDD:274556 20/78 (26%)

Return to query results.
Submit another query.