DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32554 and LAC13

DIOPT Version :10

Sequence 1:NP_728102.1 Gene:CG32554 / 32767 FlyBaseID:FBgn0052554 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_196330.3 Gene:LAC13 / 830604 AraportID:AT5G07130 Length:569 Species:Arabidopsis thaliana


Alignment Length:69 Identity:16/69 - (23%)
Similarity:25/69 - (36%) Gaps:15/69 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DSVVVTGN------SILEGRDLLAWAQKKTRHD------KVFQYR---ASDPNATKLVAIEPTNE 214
            :|:.|.|.      .:..|..|:..|..|.|::      .:.|.|   |..|.......|:|...
plant    43 NSITVNGQFPGPTLEVRNGDSLVITAINKARYNISLHWHGIRQMRNPWADGPEYITQCPIQPGGS 107

  Fly   215 FTKR 218
            :|.|
plant   108 YTYR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32554NP_728102.1 None
LAC13NP_196330.3 laccase 21..569 CDD:274556 16/69 (23%)

Return to query results.
Submit another query.