DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32554 and CP

DIOPT Version :10

Sequence 1:NP_728102.1 Gene:CG32554 / 32767 FlyBaseID:FBgn0052554 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_011510737.1 Gene:CP / 1356 HGNCID:2295 Length:1094 Species:Homo sapiens


Alignment Length:63 Identity:18/63 - (28%)
Similarity:30/63 - (47%) Gaps:8/63 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 AWAQKKTRH----DKVFQYRASDPNATKLVAIEPTNEFTKRRRQNNWNE-SRISKKMSNKQNT 239
            |||::|..:    :..:.| |||....||::::  .|.:....||..:. .|:.||....|.|
Human    17 AWAKEKHYYIGIIETTWDY-ASDHGEKKLISVD--TEHSNIYLQNGPDRIGRLYKKALYLQYT 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32554NP_728102.1 None
CPXP_011510737.1 CuRO_1_ceruloplasmin 22..202 CDD:259884 15/58 (26%)
CuRO_2_ceruloplasmin 214..354 CDD:259907
CuRO_3_ceruloplasmin 369..572 CDD:259886
CuRO_4_ceruloplasmin 575..718 CDD:259908
CuRO_5_ceruloplasmin 732..902 CDD:259887
CuRO_6_ceruloplasmin 913..1057 CDD:259898
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.