DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt7 and Supt7l

DIOPT Version :9

Sequence 1:NP_573248.2 Gene:Spt7 / 32766 FlyBaseID:FBgn0030874 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001101480.1 Gene:Supt7l / 313905 RGDID:1562206 Length:412 Species:Rattus norvegicus


Alignment Length:385 Identity:74/385 - (19%)
Similarity:146/385 - (37%) Gaps:74/385 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HWGSLPAEDDGGQLTPDKY--VPTAAKKLKLDEIRQRGDP---QPQEKHHK----LELRS---AL 57
            :||.:|.  ..||.....:  :|   ::.:|.|:.   ||   ||.....|    |::.|   :|
  Rat     4 YWGEIPI--PSGQTNRSSFDLLP---REFRLVEVH---DPPLHQPSANKPKPPTMLDIPSEPCSL 60

  Fly    58 VTQTIEVMKQTEVLQSLIETYSNKN--------GSSNYLLNPCLMIPEV--DFPP-----ENAAE 107
            ...||::::....|:|||.|...::        ...:..|..|...|.:  |..|     .||..
  Rat    61 TIHTIQLIQHNRRLRSLIATAQTQSQQQSEGVKAEESEPLPSCPGSPPLPDDLQPLDCKNPNAPF 125

  Fly   108 LVGSQKFQKPIWFTPTVDTAYSRGDPEAYPEIPSSACRQAMRKVMCGMLRLAGFTDCSESAVQLL 172
            .:   :...|       ::.:.||..|...|:...:|||.:.:.:..:|..|||...:||.::.|
  Rat   126 QI---RHSDP-------ESDFYRGKGEPVTELSWHSCRQLLYQAVATILAHAGFECANESVLETL 180

  Fly   173 TDATEEFLRSFIGEYRGYYDSQPRLQNS---TVLQLVPLERAHFAQTGT-SLTQVHNYYKHKVLA 233
            ||...|:...|....|...|.:..|..:   .|::.|      |.:.|. |:..:..:::|::..
  Rat   181 TDVAHEYCLKFTKLLRFAVDREALLGQTPFPDVMEQV------FHEVGIGSVLSLQKFWQHRIKD 239

  Fly   234 RNRAEIAEFNSVLQEYDKLMKESQSSMQKQHNEFNGHDFLNILDNSATGSSQSIGGMAMGDMLQD 298
            .:...:.....:.:||::::...:::...:..:.....   :.|.:...|.:....:|.||....
  Rat   240 YHTYMLQISKQLSEEYERIVNPEKATEDTKPVKIKEEP---VSDITFPVSEELEADLASGDQSLP 301

  Fly   299 LG----------------GSTGSSGTVSSQQMLYGLLDGQISSNTSNMTGTSGNGSTGGN 342
            :|                .|..:|....:...|:.|...::....|.....|.:|..|.:
  Rat   302 IGVLGAQSERFPSNLEVEASPQASSAEVNASPLWNLAHVKMEPQESEEGNVSAHGVLGSD 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt7NP_573248.2 None
Supt7lNP_001101480.1 BTP 149..224 CDD:128846 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28IGQ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28598
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.