DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15814 and Rnf121

DIOPT Version :10

Sequence 1:NP_573247.2 Gene:CG15814 / 32765 FlyBaseID:FBgn0030873 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_083487.2 Gene:Rnf121 / 75212 MGIID:1922462 Length:327 Species:Mus musculus


Alignment Length:87 Identity:16/87 - (18%)
Similarity:36/87 - (41%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NGRSLDSIASSYTNGNS--------SPQQFLENESPDADEQEEKARLIAQVLELQNTLDDLSQRV 87
            |.:.|||:......|.|        .|:.:..:.:.|.||....|....::|..:....:.::::
Mouse  1009 NSQDLDSMDEFGLGGGSKASFTPFVDPRVYQTSPTDDNDESSAAAMFANELLRQEQAKLNEARKI 1073

  Fly    88 D--SVKEENLKLRSENQVLGQY 107
            .  :|...|::..|:...:.:|
Mouse  1074 SVVNVNPTNIRPHSDTPEIRKY 1095

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15814NP_573247.2 RING-H2_RNF121-like 218..272 CDD:438138
Rnf121NP_083487.2 RING-H2_RNF121-like 224..278 CDD:438138
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.