DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and Slc25a14

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_006257593.1 Gene:Slc25a14 / 85263 RGDID:621433 Length:344 Species:Rattus norvegicus


Alignment Length:342 Identity:113/342 - (33%)
Similarity:191/342 - (55%) Gaps:45/342 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PAVASSTSSNPA-------PSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTR 67
            |.|.:|.|.:.|       .|:..|::..:.:.       .::...:|:.:||..|:|:||||||
  Rat    29 PTVVASASQSSAELEQHQKSSALSHEMSGLNWK-------PFVYGGLASIVAEFGTFPVDLTKTR 86

  Fly    68 LQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRK 132
            ||:||:..  ......::||||....|.|.||||.|.|:.|:.|||.|...|..::|..|..:::
  Rat    87 LQVQGQSI--DVRFKEIKYRGMFHALFRIYREEGILALYSGIAPALLRQASYGTIKIGIYQSLKR 149

  Fly   133 EFTQN-GTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEG---RRRLMGEPPRVHSAGHA 193
            .|.:. ..:.|.:  :.:|||.:|.::..:|:|.|::|:::|.:|   :..::|          :
  Rat   150 LFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIG----------S 202

  Fly   194 FRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYD-TIKHLIMNRLQMPDCHTVHVLASVCAGF 257
            |..|.|:.|.:|||:|.:|..||||:|...:|..|| |.||||::.: :.|....|.::|...|.
  Rat   203 FIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGM-LGDTILTHFVSSFTCGL 266

  Fly   258 VAAIMGTPADVVKTRIMNQPTDENGRGL-----LYRGSVDCLRQTVSKEGFVALYKGFLPCWIRM 317
            ..|:...|.|||:||:|||      |.:     ||:|::|.:.:....|||.||||||.|.|:|:
  Rat   267 AGALASNPVDVVRTRMMNQ------RAIVGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRL 325

  Fly   318 APWSLTFWLSFEQIRKM 334
            .||::.|::::||::::
  Rat   326 GPWNIIFFITYEQLKRL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 106/306 (35%)
Mito_carr 39..138 CDD:278578 36/99 (36%)
Mito_carr 142..239 CDD:278578 34/100 (34%)
Mito_carr 248..336 CDD:278578 35/92 (38%)
Slc25a14XP_006257593.1 PTZ00169 63..342 CDD:240302 106/299 (35%)
Mito_carr 253..342 CDD:395101 35/94 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.