DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and SLC25A11

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens


Alignment Length:358 Identity:99/358 - (27%)
Similarity:163/358 - (45%) Gaps:61/358 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VASSTSSNPAPSSGRHQLRP--VKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEG 74
            :|::.|:......|:.:..|  |||          :...:|...|.:...||||.|.|:|:.|||
Human     1 MAATASAGAGGIDGKPRTSPKSVKF----------LFGGLAGMGATVFVQPLDLVKNRMQLSGEG 55

  Fly    75 AAHSAGKSNMQ----------YRGMVATAFGIAREEGALKLWQG--------VTP-------ALY 114
            |.....|::..          .||:....:|: |.||  :||.|        :||       .|.
Human    56 AKTREYKTSFHALTSILKAEGLRGIYTGYWGL-RMEG--RLWVGSSRPWPDMLTPLLLRLSAGLL 117

  Fly   115 RHVVYSGVRICSYDLMRKEFTQNGTQALP--VWKSALCGVTAGAVAQWLASPADLVKVQIQMEGR 177
            |...|:..|:..|.::.:..|  |....|  ....|:.|:||||...::.:||::..:::..:| 
Human   118 RQATYTTTRLGIYTVLFERLT--GADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADG- 179

  Fly   178 RRLMGEPPRVH-SAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQM 241
             ||..:..|.: :..:|..:|.:..|:..||:|.||.:.||.:||...|.:|...|..:::....
Human   180 -RLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYF 243

  Fly   242 PDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMN------QPTDENGRGLLYRGSVDCLRQTVSK 300
            .|....|..||:.:|.|......|.|:.||||.|      :|..:||        :|.|.:.|..
Human   244 SDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNG--------LDVLFKVVRY 300

  Fly   301 EGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333
            |||.:|:|||.|.:.|:.|.::..::..||:.|
Human   301 EGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 92/329 (28%)
Mito_carr 39..138 CDD:278578 31/123 (25%)
Mito_carr 142..239 CDD:278578 28/99 (28%)
Mito_carr 248..336 CDD:278578 31/92 (34%)
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 18/70 (26%)
Mito_carr 144..241 CDD:278578 28/98 (29%)
Mito_carr 243..337 CDD:278578 32/99 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.