DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and ucp1

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_955817.1 Gene:ucp1 / 83908 ZFINID:ZDB-GENE-010503-1 Length:309 Species:Danio rerio


Alignment Length:292 Identity:111/292 - (38%)
Similarity:169/292 - (57%) Gaps:16/292 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALY 114
            ||.||:|.|:|||..|.|||||||.|...|.| .::|:|:..|...:.|.||...|:.|:...|.
Zfish    23 AACIADLVTFPLDTAKVRLQIQGEKAVTGAAK-GIRYKGVFGTISTMMRTEGPRSLYNGLVAGLQ 86

  Fly   115 RHVVYSGVRICSYDLMRKEFTQ---NGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEG 176
            |.:.::.:||..||.::..:|:   |...|:.:    |.|.|.||:|..:|.|.|:|||:.|  .
Zfish    87 RQMAFASIRIGLYDNVKSFYTRGKDNPNVAVRI----LAGCTTGAMAVSMAQPTDVVKVRFQ--A 145

  Fly   177 RRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQM 241
            :..|.|...|.:....|:|||.|..|::|||||::||:.|.||||..:|.:||.||..|:....:
Zfish   146 QMNLQGVGRRYNGTMQAYRQIFQLEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKHRLL 210

  Fly   242 PDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVAL 306
            .|....|.:::..|||:..::.:|.||||||.||.|..:      |..|.:|....::|||..|.
Zfish   211 SDNLPCHFVSAFGAGFITTVIASPVDVVKTRYMNSPPGQ------YSSSTNCAWTMLTKEGPTAF 269

  Fly   307 YKGFLPCWIRMAPWSLTFWLSFEQIRKMIGAS 338
            ||||:|.::|:..|::..::||||:::.:..|
Zfish   270 YKGFVPSFLRLGSWNVVMFVSFEQLKRAMMVS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 110/287 (38%)
Mito_carr 39..138 CDD:278578 35/90 (39%)
Mito_carr 142..239 CDD:278578 40/96 (42%)
Mito_carr 248..336 CDD:278578 32/87 (37%)
ucp1NP_955817.1 Mito_carr 10..110 CDD:395101 35/87 (40%)
Mito_carr 111..208 CDD:395101 42/102 (41%)
Mito_carr 213..299 CDD:395101 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.