DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and DIC3

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_196509.1 Gene:DIC3 / 830806 AraportID:AT5G09470 Length:337 Species:Arabidopsis thaliana


Alignment Length:334 Identity:103/334 - (30%)
Similarity:154/334 - (46%) Gaps:59/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VAASIAELATYPLDLTKTRLQIQGEGA-------------------------------------- 75
            :||.||...|:||||.|.|:|:|||.:                                      
plant    11 IAAIIAGALTHPLDLIKVRMQLQGEHSFSLDQNPNPNLSLDHNLPVKPYRPVFALDSLIGSISLL 75

  Fly    76 ---AHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQN 137
               .|:...|........|....|.:.||...|:.||:..:.|.::||..|:..||.:::.:|..
plant    76 PLHIHAPSSSTRSVMTPFAVGAHIVKTEGPAALFSGVSATILRQMLYSATRMGIYDFLKRRWTDQ 140

  Fly   138 GTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEG-----RRRLMGEPPRVHSAGHAFRQI 197
            .|...|:......|:.||||...:.:|||:..|::|.:|     |||      ...|...|..:|
plant   141 LTGNFPLVTKITAGLIAGAVGSVVGNPADVAMVRMQADGSLPLNRRR------NYKSVVDAIDRI 199

  Fly   198 VQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKH-LIMNRLQMPDCHTVHVLASVCAGFVAAI 261
            .::.|:..||:||...|.||.:|....|.|||.:|. |:......|.....||.||..||.|||:
plant   200 ARQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAGGRGTPGGIGTHVAASFAAGIVAAV 264

  Fly   262 MGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWL 326
            ...|.||||||:||...:      :|.|.:||..:.|::||.:|||||.:|...|..|:::..:|
plant   265 ASNPIDVVKTRMMNADKE------IYGGPLDCAVKMVAEEGPMALYKGLVPTATRQGPFTMILFL 323

  Fly   327 SFEQIRKMI 335
            :.||:|.::
plant   324 TLEQVRGLL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 103/332 (31%)
Mito_carr 39..138 CDD:278578 31/129 (24%)
Mito_carr 142..239 CDD:278578 33/102 (32%)
Mito_carr 248..336 CDD:278578 37/88 (42%)
DIC3NP_196509.1 Mito_carr <19..139 CDD:395101 26/119 (22%)
Mito_carr 143..238 CDD:395101 32/100 (32%)
Mito_carr 251..336 CDD:395101 37/88 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.