DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and PUMP1

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_190979.1 Gene:PUMP1 / 824578 AraportID:AT3G54110 Length:306 Species:Arabidopsis thaliana


Alignment Length:303 Identity:114/303 - (37%)
Similarity:176/303 - (58%) Gaps:25/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNM-QYRGMVATAFGIAREEGA 102
            :|||    |..||.:.|:.|.|||..|.|||:|....   ||...: :|||::.|...||||||.
plant    14 TFAC----SAFAACVGEVCTIPLDTAKVRLQLQKSAL---AGDVTLPKYRGLLGTVGTIAREEGL 71

  Fly   103 LKLWQGVTPALYRHVVYSGVRICSYDLMR-----KEFTQNGTQALPVWKSALCGVTAGAVAQWLA 162
            ..||:||.|.|:|..::.|:||..|:.::     |:|..:    :|:.|..|.|:|.||:...:|
plant    72 RSLWKGVVPGLHRQCLFGGLRIGMYEPVKNLYVGKDFVGD----VPLSKKILAGLTTGALGIMVA 132

  Fly   163 SPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTT 227
            :|.|||||::|.|| :...|.|.|...|.:|:..||::.|::.||.|..|||.|.|::|..:|.:
plant   133 NPTDLVKVRLQAEG-KLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAELAS 196

  Fly   228 YDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVD 292
            ||.:|..|:......|....|:|:.:.|||.|..:|:|.||||:|:|       |....|:|::|
plant   197 YDQVKETILKIPGFTDNVVTHILSGLGAGFFAVCIGSPVDVVKSRMM-------GDSGAYKGTID 254

  Fly   293 CLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMI 335
            |..:|:..:|.:|.||||:|.:.|:..|::..:|:.||.:|.:
plant   255 CFVKTLKSDGPMAFYKGFIPNFGRLGSWNVIMFLTLEQAKKYV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 114/301 (38%)
Mito_carr 39..138 CDD:278578 41/104 (39%)
Mito_carr 142..239 CDD:278578 39/96 (41%)
Mito_carr 248..336 CDD:278578 33/88 (38%)
PUMP1NP_190979.1 Mito_carr 7..106 CDD:395101 39/98 (40%)
Mito_carr 110..206 CDD:395101 39/100 (39%)
Mito_carr 210..299 CDD:395101 34/95 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3271
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.