DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and UCP5

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_179836.1 Gene:UCP5 / 816783 AraportID:AT2G22500 Length:313 Species:Arabidopsis thaliana


Alignment Length:299 Identity:102/299 - (34%)
Similarity:167/299 - (55%) Gaps:15/299 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VAASIAELATYPLDLTKTRLQIQGEGAAHSAG-KSNMQYR------------GMVATAFGIAREE 100
            :|:.:|..:|:||||.|.|:|:|||.|..... :..:.::            |::.....:.|||
plant    11 IASIVAGCSTHPLDLIKVRMQLQGESAPIQTNLRPALAFQTSTTVNAPPLRVGVIGVGSRLIREE 75

  Fly   101 GALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPA 165
            |...|:.||:..:.|..:||..|:..||:::.|:|...|:.:|:.|....|..|||:...:.:||
plant    76 GMRALFSGVSATVLRQTLYSTTRMGLYDIIKGEWTDPETKTMPLMKKIGAGAIAGAIGAAVGNPA 140

  Fly   166 DLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDT 230
            |:..|::|.:||..|. :.....|...|..|:::..|:..||:||...:.||.||....|.:||:
plant   141 DVAMVRMQADGRLPLT-DRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINRAMLVTSSQLASYDS 204

  Fly   231 IKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLR 295
            :|..|:.:..:.|....||.||..|||||::...|.||:|||:||... ..|....|:|:|||..
plant   205 VKETILEKGLLKDGLGTHVSASFAAGFVASVASNPVDVIKTRVMNMKV-VAGVAPPYKGAVDCAL 268

  Fly   296 QTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKM 334
            :||..||.::|||||:|...|.||:::..:::.||::|:
plant   269 KTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVTLEQVKKL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 102/299 (34%)
Mito_carr 39..138 CDD:278578 30/101 (30%)
Mito_carr 142..239 CDD:278578 31/96 (32%)
Mito_carr 248..336 CDD:278578 39/87 (45%)
UCP5NP_179836.1 Mito_carr 3..106 CDD:395101 28/94 (30%)
Mito_carr <136..213 CDD:395101 25/77 (32%)
Mito_carr 216..311 CDD:395101 40/93 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.