DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and ucp3

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_956647.2 Gene:ucp3 / 794081 ZFINID:ZDB-GENE-040426-1317 Length:309 Species:Danio rerio


Alignment Length:305 Identity:114/305 - (37%)
Similarity:171/305 - (56%) Gaps:12/305 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATA 93
            ::|.  |...:.|..:..:..||..|:|.|:|||..|.|||||||... :.|.:.::|||:..|.
Zfish     4 IKPT--DLPPTAAVKFFGAGTAACFADLVTFPLDTAKVRLQIQGESGT-APGSAVLKYRGVFGTI 65

  Fly    94 FGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVA 158
            ..:.|.|||..|:.|:...|.|.:.::.|||..||.| |:|...|::...:....|.|.|.||:|
Zfish    66 TTMVRTEGARSLYNGLVAGLQRQMSFASVRIGLYDSM-KQFYTRGSENASIVTRLLAGCTTGAMA 129

  Fly   159 QWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLG 223
            ...|.|.|:|||:.|.:.|....|:  |.:....|:|.|.:..|::|||||.:||:.|.|:||..
Zfish   130 VAFAQPTDVVKVRFQAQVRHTDGGK--RYNGTMDAYRTIARDEGVRGLWKGCMPNITRNAIVNCA 192

  Fly   224 DLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYR 288
            :|.|||.||.||:....|.|....|..|:..|||...|:.:|.||||||.||....:      |.
Zfish   193 ELVTYDIIKDLILKYDLMTDNLPCHFTAAFGAGFCTTIVASPVDVVKTRFMNSSAGQ------YG 251

  Fly   289 GSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRK 333
            .:::|....::|||..|.||||:|.::|:..|::..::|:|||::
Zfish   252 SALNCALMMLTKEGPAAFYKGFMPSFLRLGSWNIVMFVSYEQIKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 112/295 (38%)
Mito_carr 39..138 CDD:278578 38/98 (39%)
Mito_carr 142..239 CDD:278578 39/96 (41%)
Mito_carr 248..336 CDD:278578 32/86 (37%)
ucp3NP_956647.2 Mito_carr 10..110 CDD:278578 38/101 (38%)
PTZ00169 14..298 CDD:240302 112/293 (38%)
Mito_carr 114..207 CDD:278578 39/94 (41%)
Mito_carr 211..301 CDD:278578 33/92 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.