DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and Slc25a11

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_071793.2 Gene:Slc25a11 / 64201 RGDID:708476 Length:314 Species:Rattus norvegicus


Alignment Length:332 Identity:94/332 - (28%)
Similarity:156/332 - (46%) Gaps:43/332 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSNPAPSSGRHQLRP------VKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGA 75
            ::..:|.:||...:|      |||          :...:|...|.:...||||.|.|:|:.||||
  Rat     2 AATASPGAGRMDGKPRTSPKSVKF----------LFGGLAGMGATVFVQPLDLVKNRMQLSGEGA 56

  Fly    76 AHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQ 140
                  ...:|:........|.:.||...::.|::..|.|...|:..|:..|.::.:..|  |..
  Rat    57 ------KTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLT--GAD 113

  Fly   141 ALP--VWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVH-SAGHAFRQIVQRGG 202
            ..|  ....||.|:||||...::.:||::..:::..:|  ||..:..|.: :..:|..:|.:..|
  Rat   114 GTPPGFLLKALIGMTAGATGAFVGTPAEVALIRMTADG--RLPADQRRGYKNVFNALIRIAREEG 176

  Fly   203 IKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPAD 267
            :..||:|.||.:.||.:||...|.:|...|..:::.....|....|..||:.:|.|......|.|
  Rat   177 VPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVD 241

  Fly   268 VVKTRIMN------QPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWL 326
            :|||||.|      :|..:||        :|.|.:.|..|||.:|:|||.|.:.|:.|.::..::
  Rat   242 IVKTRIQNMRMIDGKPEYKNG--------LDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFI 298

  Fly   327 SFEQIRK 333
            ..||:.|
  Rat   299 FLEQMNK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 87/304 (29%)
Mito_carr 39..138 CDD:278578 24/98 (24%)
Mito_carr 142..239 CDD:278578 29/99 (29%)
Mito_carr 248..336 CDD:278578 32/92 (35%)
Slc25a11NP_071793.2 Solcar 1 23..108 26/100 (26%)
Mito_carr 24..102 CDD:395101 24/93 (26%)
Mito_carr 116..213 CDD:395101 29/98 (30%)
Solcar 2 117..208 28/92 (30%)
Mito_carr 215..313 CDD:395101 33/99 (33%)
Solcar 3 217..306 33/97 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.