DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and slc25a27

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001011241.1 Gene:slc25a27 / 496683 XenbaseID:XB-GENE-1005902 Length:319 Species:Xenopus tropicalis


Alignment Length:300 Identity:181/300 - (60%)
Similarity:229/300 - (76%) Gaps:3/300 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGK--SNMQYRGMVATAFGIAREEGALKLW 106
            :|:|..|||:|||.|:||||||||||||||.|....|:  |.:.|||||.||.||.:|||.||||
 Frog    20 FILSACAASVAELVTFPLDLTKTRLQIQGEAALKRHGEVGSAVPYRGMVRTATGIVQEEGLLKLW 84

  Fly   107 QGVTPALYRHVVYSGVRICSYDLMRKEFTQNGT-QALPVWKSALCGVTAGAVAQWLASPADLVKV 170
            ||.|||:|||:||||||:.:|:.:|......|. ...|:|||.:.|:||||:.|:.|||.|||||
 Frog    85 QGATPAVYRHIVYSGVRMVAYEHIRDSVLGKGDGDTFPLWKSVVGGMTAGAIGQFFASPTDLVKV 149

  Fly   171 QIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLI 235
            |:||||:|||.|:||||....|||..||.:|||:|||.|.:||||||||||:|||||||.:||.:
 Frog   150 QMQMEGKRRLEGKPPRVRGVYHAFVTIVSKGGIRGLWAGWVPNVQRAALVNMGDLTTYDMVKHFL 214

  Fly   236 MNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSK 300
            :....:.|....|.::|:|:|.|||.:||||||:||||||||.|::||||||:.|.|||.|.:..
 Frog   215 LRNTPIKDNSLCHTISSICSGVVAATLGTPADVIKTRIMNQPRDKHGRGLLYKSSTDCLIQAIRG 279

  Fly   301 EGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIGASGY 340
            |||::|||||:|.|:|||||||.|||::||||::.|.|.:
 Frog   280 EGFMSLYKGFMPTWMRMAPWSLVFWLTYEQIRRLGGVSSF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 179/293 (61%)
Mito_carr 39..138 CDD:278578 58/95 (61%)
Mito_carr 142..239 CDD:278578 62/96 (65%)
Mito_carr 248..336 CDD:278578 57/87 (66%)
slc25a27NP_001011241.1 Mito_carr 18..114 CDD:365909 58/93 (62%)
Mito_carr 122..216 CDD:365909 62/93 (67%)
Mito_carr 223..313 CDD:365909 57/89 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4859
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12523
Inparanoid 1 1.050 379 1.000 Inparanoid score I2021
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 1 1.000 - - otm48174
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3442
SonicParanoid 1 1.000 - - X3722
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.