DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ucp4A and rangrf

DIOPT Version :9

Sequence 1:	NP_001188664.1	Gene:	Ucp4A / 32764	FlyBaseID:	FBgn0030872	Length:	340	Species:	Drosophila melanogaster
Sequence 2:	XP_002941865.3	Gene:	rangrf / 496602	XenbaseID:	XB-GENE-5760490	Length:	238	Species:	Xenopus tropicalis

Alignment Length:	48	Identity:	13/48 - (27%)
Similarity:	21/48 - (43%)	Gaps:	8/48 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 ASSTSSNPAPSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYP 60
            |||..|..|..|..|.|      :|.:|:.  ::...:..::||...|
Frog    43 ASSADSPMAQDSQPHPL------FAGAFSA--VLPPFSQDVSELREIP 82

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ucp4A	NP_001188664.1	PTZ00169	39..335	CDD:240302	4/22 (18%)
		Mito_carr	39..138	CDD:278578	4/22 (18%)
		Mito_carr	142..239	CDD:278578
		Mito_carr	248..336	CDD:278578
rangrf	XP_002941865.3	Mog1	58..238	CDD:238137	6/33 (18%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910