DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and CG4743

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:330 Identity:77/330 - (23%)
Similarity:130/330 - (39%) Gaps:84/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGI 96
            :||.:|      .:...||..:.::|.:|:|..|||||                      :..|.
  Fly    25 LKFFHA------LVAGGVAGMVVDIALFPIDTVKTRLQ----------------------SELGF 61

  Fly    97 AREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWL 161
            .|..|...:::|:.||.......:.:..|:|: ..|:|..:.||..   .|....:.|.:.|:.|
  Fly    62 WRAGGFRGIYKGLAPAAAGSAPTAALFFCTYE-CGKQFLSSVTQTK---DSPYVHMAAASAAEVL 122

  Fly   162 ASPADLVKVQIQMEGRR--RLMGEPPRVHSAGHAFRQIVQRG----GIK-GLWKGSIPNVQRAAL 219
            |.   |::|.:::..:|  .|.|..       .:..||:.|.    |:| ||::|....:.|...
  Fly   123 AC---LIRVPVEIAKQRSQTLQGNK-------QSGLQILLRAYRTEGLKRGLYRGFGSTIMREIP 177

  Fly   220 VNL-------------GDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKT 271
            .:|             ..||.:|:....:             .|....||.::|.:.||.|||||
  Fly   178 FSLIQFPLWEYFKLQWTPLTGFDSTPFSV-------------ALCGAVAGGISAGLTTPLDVVKT 229

  Fly   272 RIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLP--CWIRMAPWSLTFWLSFEQI-RK 333
            |||....:...|   .|.:...|.....:.||..|:.||:|  .||.:..   .|:..|..: .:
  Fly   230 RIMLAERESLNR---RRSARRILHGIYLERGFSGLFAGFVPRVLWITLGG---AFFFGFYDLTTR 288

  Fly   334 MIGAS 338
            ::||:
  Fly   289 ILGAT 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 72/318 (23%)
Mito_carr 39..138 CDD:278578 20/98 (20%)
Mito_carr 142..239 CDD:278578 23/116 (20%)
Mito_carr 248..336 CDD:278578 27/90 (30%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 22/102 (22%)
PTZ00168 25..281 CDD:185494 74/316 (23%)
Mito_carr 199..291 CDD:278578 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.