DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and CG5805

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:359 Identity:81/359 - (22%)
Similarity:142/359 - (39%) Gaps:65/359 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ESSPAVASSTSSNP----APSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTR 67
            |||.:..|..:..|    ..:.|...:|.:::|..:. ...:.:|::::.......:||.:.||:
  Fly     3 ESSSSTKSRLAVAPTGVGGAAEGATYIRTIEWDMMNK-TKFFPLSMLSSFSVRCCLFPLTVIKTQ 66

  Fly    68 LQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICS------ 126
            ||:|     |   ||:: |:|||..|..|.|.||        .|.|||....|.|:|.|      
  Fly    67 LQVQ-----H---KSDV-YKGMVDCAMKIYRSEG--------VPGLYRGFWISSVQIVSGVFYIS 114

  Fly   127 -YDLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEP------ 184
             |:.:|......|  |....|:...|..|..|.|.:..|.|::.....:.|.....|..      
  Fly   115 TYEGVRHVLNDLG--AGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPL 177

  Fly   185 --------PRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQM 241
                    .|:|.:....|:|::|.|.:|.::|...::    :..:.:...:....||..:.| .
  Fly   178 GIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASL----MAYVPNSAMWWAFYHLYQDEL-F 237

  Fly   242 PDCHT------VHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSK 300
            ..|..      :..:|....||...|:..|.|:|:.|:.....|..        || ..|:...:
  Fly   238 RICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRLDSM--------SV-AFRELWQE 293

  Fly   301 EGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKM 334
            |.....:||.....::.|.:|.:..|.:|.|:::
  Fly   294 EKLNCFFKGLSARLVQSAAFSFSIILGYETIKRI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 73/323 (23%)
Mito_carr 39..138 CDD:278578 30/105 (29%)
Mito_carr 142..239 CDD:278578 19/110 (17%)
Mito_carr 248..336 CDD:278578 20/87 (23%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 30/95 (32%)
Mito_carr 132..238 CDD:395101 20/110 (18%)
Mito_carr 245..327 CDD:395101 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.