DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and DPCoAC

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:341 Identity:77/341 - (22%)
Similarity:132/341 - (38%) Gaps:61/341 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAKTDESSPAVASSTSSNPAPSSG-----RHQLRPVKFDYADSFACTYIVSVVAASIAELATYPL 61
            |..:.:...|..|.|..:|:.:||     ...:.|:: ...|....:.|....|.::|:....||
  Fly    30 ATLSSDLDDADTSRTQLSPSETSGVVLVPATTVTPMR-QKIDQVVISLISGAAAGALAKTVIAPL 93

  Fly    62 DLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICS 126
            |.||...||:.:        ....:|..:.........||.|.||:|.:..:.|.|.|:.::..:
  Fly    94 DRTKINFQIRND--------VPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTA 150

  Fly   127 YDLMRK--EFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHS 189
            ::..|:  ...::||..  ..:..|.|..||..:|.|..|.||.:.::.:..|          ::
  Fly   151 HEQWRRILHVDKDGTNT--KGRRFLAGSLAGITSQSLTYPLDLARARMAVTDR----------YT 203

  Fly   190 AGHAFRQI-----VQRGG---IKGLWK---GSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPD 243
            .....||:     |:.|.   .:|.|.   |.||....:       ..||:|:|.   ...::..
  Fly   204 GYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTS-------FFTYETLKR---EYYEVVG 258

  Fly   244 CHTVHVLASVCAGFVAAIMGT----PADVVKTRIMNQPTDENGRGLLYRGSVDCL----RQTVSK 300
            .:..:.|.|:..|..|...|.    |.|:|:.|:.....:..| |..|...::.|    |:...|
  Fly   259 NNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAG-GDRYPTILETLVKIYREEGVK 322

  Fly   301 EGFVALYKGFLPCWIR 316
            .||   |||....||:
  Fly   323 NGF---YKGLSMNWIK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 68/299 (23%)
Mito_carr 39..138 CDD:278578 21/100 (21%)
Mito_carr 142..239 CDD:278578 23/107 (21%)
Mito_carr 248..336 CDD:278578 22/77 (29%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 21/94 (22%)
Mito_carr 169..251 CDD:278578 22/98 (22%)
Mito_carr 279..356 CDD:278578 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.