DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and slc25a11

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001002099.1 Gene:slc25a11 / 415189 ZFINID:ZDB-GENE-040625-79 Length:308 Species:Danio rerio


Alignment Length:343 Identity:92/343 - (26%)
Similarity:154/343 - (44%) Gaps:54/343 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKTDESSPAVASSTSSNPAPSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTK 65
            |||..|.:.|        ..:|.|       :||          :...:|...|.:...||||.|
Zfish     1 MAAAADTAKP--------KTSPKS-------IKF----------LFGGLAGMGATVFVQPLDLVK 40

  Fly    66 TRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLM 130
            .|:|:.|:|:.....|::....|      .|.|.||...::.|::..|.|...|:..|:..|.::
Zfish    41 NRMQLSGQGSKAREYKTSFHAVG------SILRNEGVRGIYTGLSAGLLRQATYTTTRLGIYTIL 99

  Fly   131 RKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVH----SAG 191
            .:..::........:..||.|:||||...::.:||::..:::..:||.     ||...    :..
Zfish   100 FERMSKADGTPPNFFMKALIGMTAGATGAFVGTPAEVALIRMTADGRL-----PPDQRRGYTNVF 159

  Fly   192 HAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAG 256
            :|..:|.:..|:..||:|.||.:.||.:||...|.:|...|..:::.....|....|..||:.:|
Zfish   160 NALVRITREEGVTTLWRGCIPTMARAVVVNAAQLASYSQSKQALLDSGYFRDDILCHFCASMISG 224

  Fly   257 FVAAIMGTPADVVKTRIMN------QPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWI 315
            .|......|.|:|||||.|      :|...||        :|.|.:.:..|||.:|:|||.|.:.
Zfish   225 LVTTAASMPVDIVKTRIQNMRMIDGKPEYNNG--------LDVLVKVIRNEGFFSLWKGFTPYYA 281

  Fly   316 RMAPWSLTFWLSFEQIRK 333
            |:.|.::..::..||:.|
Zfish   282 RLGPHTVLTFIFLEQMNK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 83/305 (27%)
Mito_carr 39..138 CDD:278578 23/98 (23%)
Mito_carr 142..239 CDD:278578 28/100 (28%)
Mito_carr 248..336 CDD:278578 31/92 (34%)
slc25a11NP_001002099.1 Mito_carr 18..96 CDD:278578 24/93 (26%)
PTZ00169 19..300 CDD:240302 84/310 (27%)
Mito_carr 110..207 CDD:278578 28/101 (28%)
Mito_carr 213..305 CDD:278578 31/95 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.