DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and GC2

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:325 Identity:80/325 - (24%)
Similarity:136/325 - (41%) Gaps:72/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMV 90
            :.|.:|.||:.....    |...||..|.....||||:.|||||.|      :.|.:..:....:
  Fly    10 QEQKKPQKFNVFPKI----INGGVAGIIGVACVYPLDMVKTRLQNQ------TIGPNGERMYTSI 64

  Fly    91 ATAF--GIAREEGALKLWQG-------VTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWK 146
            |..|  .|| .||...:::|       :||.       ..:::.:.|..|.....: ...:|:.:
  Fly    65 ADCFRKTIA-SEGYFGMYRGSAVNIVLITPE-------KAIKLTANDFFRYHLASD-DGVIPLSR 120

  Fly   147 SALCGVTAGAVAQWLASPADLVKVQIQMEGR----RRLMGEPPRVHSAGHAFRQIVQRGGIKGLW 207
            :.|.|..||.....:.:|.:|:|:|:|..||    .|..|...:..:|....:.:::..||.||:
  Fly   121 ATLAGGLAGLFQIVVTTPMELLKIQMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLY 185

  Fly   208 KGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVH------------------VLASVC 254
            ||       .....:.|:|         .:.:..|....::                  ::|.:.
  Fly   186 KG-------VGATGVRDIT---------FSMVYFPLMAWINDQGPRKSDGSGEAVFYWSLIAGLL 234

  Fly   255 AGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAP 319
            :|..:|.|.||.||||||:  |...|.    .::|.:||:.:|:.:||..|.:||.|...:.:||
  Fly   235 SGMTSAFMVTPFDVVKTRL--QADGEK----KFKGIMDCVNRTLKEEGISAFFKGGLCRIMVLAP 293

  Fly   320  319
              Fly   294  293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 76/312 (24%)
Mito_carr 39..138 CDD:278578 26/107 (24%)
Mito_carr 142..239 CDD:278578 23/100 (23%)
Mito_carr 248..336 CDD:278578 26/90 (29%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 77/315 (24%)
Mito_carr 16..106 CDD:278578 27/107 (25%)
Mito_carr 123..203 CDD:278578 22/95 (23%)
Mito_carr 228..302 CDD:278578 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.