DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and CG2616

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:380 Identity:95/380 - (25%)
Similarity:159/380 - (41%) Gaps:76/380 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AAKTDESSPAVASSTSSN-PAPSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTK 65
            :|:.|::...:..|.||: ...|..|.|:||::...:   |||      .|.|......|||:.|
  Fly    60 SAREDDAINRLTDSKSSHRKLLSDPRFQIRPLQQVIS---ACT------GAMITACFMTPLDVIK 115

  Fly    66 TRLQIQGEGAAH--------------SAGK-----SNMQYRGMVATAFG----IAREEGALKLWQ 107
            ||:|.| :..||              ::|.     ::::.|...::::.    |:|.||...||.
  Fly   116 TRMQSQ-QSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWS 179

  Fly   108 GVTPALYRHVVYSGVRICSYDLMRKEFTQ------NGTQ------------ALPVWKSALCGVTA 154
            |:.|.|...:..:.:...:|:..:..:.|      |.:|            :||.....:.||||
  Fly   180 GLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTA 244

  Fly   155 GAVAQWLASPADLV--KVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRA 217
            ...|..:.||.:||  |:|.|.:...:::          ...|.:|...|:.|||:|..|.:.|.
  Fly   245 RICAVTVVSPIELVRTKMQAQRQTYAQML----------QFVRSVVALQGVWGLWRGLRPTILRD 299

  Fly   218 ALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKT--------RIM 274
            ...:......|:::|..:.:..|  ...::..||.|.||.||||:.||.|||||        |::
  Fly   300 VPFSGIYWPIYESLKQNLGHGSQ--PSFSLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVI 362

  Fly   275 NQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFE 329
            .  ||...|....:.:...|.......|...|:.|..|..:::||.......:||
  Fly   363 F--TDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 85/342 (25%)
Mito_carr 39..138 CDD:278578 28/127 (22%)
Mito_carr 142..239 CDD:278578 25/98 (26%)
Mito_carr 248..336 CDD:278578 29/90 (32%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 30/130 (23%)
Mito_carr 230..321 CDD:278578 25/100 (25%)
Mito_carr 321..425 CDD:278578 30/99 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.