DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and CG6893

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:297 Identity:73/297 - (24%)
Similarity:127/297 - (42%) Gaps:45/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPAL 113
            ||.:||:..|.|.||.:.|:.:..:.            |||.:......|..|.:.|:.|::..|
  Fly    23 VAGAIAQCFTAPFDLIEARMVVIKKD------------RGMASNLQQAIRTHGFISLYDGLSAQL 75

  Fly   114 YRHVVYSGVRICSYDLMRKEFTQNGTQAL-PVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGR 177
            .|.:.|:.:|...|: |.||...:....| .|..:||.|..||.|    .:|.:|:..::|:   
  Fly    76 LRQLTYTSMRFHLYE-MGKEHLDDPAGLLDKVLVAALAGCVAGVV----GTPMELINTRMQV--- 132

  Fly   178 RRLMGEPPR--VHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQ 240
            .|.:.:..|  ..:......::.:..|...|:.|...:..|::|:.:.....||..|.:......
  Fly   133 NRALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFH 197

  Fly   241 MPDCHT-VHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLR--QTVS--- 299
            |...:| :|:::||.|.||...:..|.:                .|.|...||..|  .::|   
  Fly   198 MKHDNTLLHLISSVTAAFVCGPIIKPIE----------------NLRYLRMVDSRRLINSISYMM 246

  Fly   300 KEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIG 336
            :.|....::|.:|..:||.|.::..:|||||:|...|
  Fly   247 RFGSRGPFRGMVPYVLRMVPNTVITFLSFEQLRVNFG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 72/294 (24%)
Mito_carr 39..138 CDD:278578 24/88 (27%)
Mito_carr 142..239 CDD:278578 21/99 (21%)
Mito_carr 248..336 CDD:278578 25/92 (27%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 24/85 (28%)
Mito_carr 98..192 CDD:395101 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.