DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and slc25a30

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001165746.1 Gene:slc25a30 / 394840 XenbaseID:XB-GENE-995074 Length:291 Species:Xenopus tropicalis


Alignment Length:298 Identity:115/298 - (38%)
Similarity:177/298 - (59%) Gaps:24/298 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108
            :|...:|:..||..|:|:||||||||:||:  |:.|....::||||:.....|.:|||...|:.|
 Frog     9 FIYGGLASITAECGTFPIDLTKTRLQVQGQ--ANDAKYKEIRYRGMLHAIVRIWKEEGVKALYSG 71

  Fly   109 VTPALYRHVVYSGVRICSYDLMRKEFT---QNGTQALPVWKSALCGVTAGAVAQWLASPADLVKV 170
            :.||:.|...|..::|.:|..:::.|.   ::.|..:.|:    |||.:|.|:..:|:|.|::|:
 Frog    72 IAPAMLRQASYGTIKIGTYQSLKRLFVDCPEDETLVINVF----CGVLSGVVSSCIANPTDVLKI 132

  Fly   171 QIQMEG---RRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYD-TI 231
            ::|.:|   :..::|.          |..|.|:.|.:|||||.....||||:|...:|..|| |.
 Frog   133 RMQAQGSLIQGGMIGN----------FINIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITK 187

  Fly   232 KHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQ 296
            ||||::.| |.|....|.|||...|...|:...|.|||:||:|||.:..|.....|:|::|||.|
 Frog   188 KHLILSGL-MGDTVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSIRNVSNSSYKGTLDCLLQ 251

  Fly   297 TVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKM 334
            |...|||.||||||.|.|:|:.||::.|::::||::|:
 Frog   252 TWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 115/298 (39%)
Mito_carr 39..138 CDD:278578 35/96 (36%)
Mito_carr 142..239 CDD:278578 35/100 (35%)
Mito_carr 248..336 CDD:278578 41/87 (47%)
slc25a30NP_001165746.1 Solcar 1 7..96 34/88 (39%)
PTZ00169 9..289 CDD:240302 114/296 (39%)
Solcar 2 104..189 32/98 (33%)
Solcar 3 198..289 41/90 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.