DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and SCaMC

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:376 Identity:70/376 - (18%)
Similarity:142/376 - (37%) Gaps:101/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 APSSGRHQLRPVKF-----------------DYADSFACT------YIVSVVAASIAELATYPLD 62
            |||:..|.|  :||                 |:......|      .:...:|.:::...|.|||
  Fly   245 APSTDIHDL--IKFWRHSTYLDIGEDMNVPDDFTQKEMQTGLWWRHLVAGGIAGAVSRTCTAPLD 307

  Fly    63 LTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSY 127
            ..|..||:|            .|..|:......:..|.|:..:|:|....:.:....:..:..:|
  Fly   308 RIKVYLQVQ------------TQRMGISECMHIMLNEGGSRSMWRGNGINVLKIAPETAFKFAAY 360

  Fly   128 DLMRKEFT-QNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAG 191
            :.|::... .:|::.:.:.:....|..||.::|.:..|.:::|.::.:....:..|       ..
  Fly   361 EQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRTGQYAG-------IA 418

  Fly   192 HAFRQIVQRGGIKGLWKGSIPNVQRAALVNLG-------DLTTYDTIKHLIM---NRLQMPDCHT 246
            .|..:|.::.|::..::|.:||:       ||       ||..|:|:|...:   :..:.|.   
  Fly   419 DAAVKIYKQEGVRSFYRGYVPNI-------LGILPYAGIDLAVYETLKRRYIANHDNNEQPS--- 473

  Fly   247 VHVLASVCAGFVAAIMGT----PADVVKTRIMNQPT----------------------DENGRGL 285
              .|..:..|..::.:|.    |..:|:||:..|..                      :|...||
  Fly   474 --FLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGL 536

  Fly   286 LYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKMIG 336
                    .|:.|.:||...||:|..|.::::.|.....::.:|...:.:|
  Fly   537 --------FRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALG 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 61/338 (18%)
Mito_carr 39..138 CDD:278578 18/105 (17%)
Mito_carr 142..239 CDD:278578 20/106 (19%)
Mito_carr 248..336 CDD:278578 21/113 (19%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 1/1 (100%)
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 17/96 (18%)
Mito_carr 375..463 CDD:278578 20/101 (20%)
Mito_carr 470..581 CDD:278578 23/123 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.