DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4A and slc25a14

DIOPT Version :9

Sequence 1:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_017208245.1 Gene:slc25a14 / 393133 ZFINID:ZDB-GENE-040426-749 Length:335 Species:Danio rerio


Alignment Length:315 Identity:122/315 - (38%)
Similarity:180/315 - (57%) Gaps:25/315 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGM 89
            |.||......:.|:.....::...:|:.:||..|:|:||||||||:||:  .|.   ..::||||
Zfish    39 GLHQAEGAATEMANLNWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQ--THC---MEVRYRGM 98

  Fly    90 VATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEFTQNGTQALPVWKSALCGVTA 154
            ......|.||||...|:.|::|||.|...|..::|.:|:.::|.|..:..:...| .:..|||.:
Zfish    99 FHALLRIGREEGVRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSHPEEETMV-INVFCGVVS 162

  Fly   155 GAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAAL 219
            |.::..||:|.|::|:::|.:| ..|.|      |....|..|.|..|.:|||:|.||..||||:
Zfish   163 GVLSSSLANPTDVLKIRMQAQG-SLLQG------SMMSNFMNIYQTEGTRGLWRGVIPTAQRAAI 220

  Fly   220 VNLGDLTTYD-TIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPADVVKTRIMNQPTDENGR 283
            |...:|..|| |.||||.:.| |.|....|.::|...|...|:...|.|||:||:|||      |
Zfish   221 VVGVELPVYDITKKHLIRSGL-MGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQ------R 278

  Fly   284 GL----LYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQIRKM 334
            .|    ||:|::|.|.||...|||.||||||.|.|:|:.||::.|:::|||::|:
Zfish   279 VLAGNPLYKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTFEQLKKL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 118/301 (39%)
Mito_carr 39..138 CDD:278578 36/98 (37%)
Mito_carr 142..239 CDD:278578 38/97 (39%)
Mito_carr 248..336 CDD:278578 41/91 (45%)
slc25a14XP_017208245.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.